SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799359|ref|YP_695971.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799359|ref|YP_695971.1|
Domain Number 1 Region: 3-167
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 1.8e-54
Family Serine acetyltransferase 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799359|ref|YP_695971.1|
Sequence length 169
Comment serine O-acetyltransferase [Clostridium perfringens ATCC 13124]
Sequence
MFKNLKYDIENVMKNDPAARTKLEVLLLYQSIHVLIFYRIAHGLYKIKLFFLARLISQLG
RFFTGIEIHPGAKIGKGLFIDHGMGVVIGETAEIGDNVTIYHGVTLGGTGKDKGKRHPTI
GNNVIIGCGAKILGPISIGDGAKIGANSVVLKNVPKGKTAVGIPAVIKN
Download sequence
Identical sequences A0A0H2YRF1 A0A174AD02 B1BHW3 B1BX72 B1RCB0 Q8XKS3
195102.CPE1321 195103.CPF_1528 gi|18310303|ref|NP_562237.1| WP_003450775.1.10161 WP_003450775.1.2058 WP_003450775.1.20964 WP_003450775.1.22226 WP_003450775.1.23119 WP_003450775.1.24595 WP_003450775.1.27257 WP_003450775.1.27537 WP_003450775.1.31832 WP_003450775.1.32463 WP_003450775.1.39851 WP_003450775.1.43003 WP_003450775.1.4402 WP_003450775.1.50147 WP_003450775.1.51349 WP_003450775.1.5234 WP_003450775.1.52659 WP_003450775.1.81392 WP_003450775.1.90682 gi|110799359|ref|YP_695971.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]