SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110799363|ref|YP_694971.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|110799363|ref|YP_694971.1|
Domain Number - Region: 58-90
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 0.036
Family Ribosomal protein L29 (L29p) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110799363|ref|YP_694971.1|
Sequence length 137
Comment hypothetical protein CPF_0517 [Clostridium perfringens ATCC 13124]
Sequence
MYVAFGNRVLDSEEIKKEIELNTDAKVVSDLCKSSKREDIIAFKLSIDMDILRGLMKENS
DLKDLNDEELFEDYLDLAEEVAGMIFEYMPEDAILDIRSYKWDMSYNDVKLIMVMAHEDL
GIAKVNDVMKRLLRQVD
Download sequence
Identical sequences A0A0H2YQY8
gi|110799363|ref|YP_694971.1| WP_003471360.1.50147 WP_003471360.1.98368 195103.CPF_0517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]