SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799373|ref|YP_695073.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799373|ref|YP_695073.1|
Domain Number 1 Region: 14-260
Classification Level Classification E-value
Superfamily MetI-like 1.64e-43
Family MetI-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110799373|ref|YP_695073.1|
Sequence length 274
Comment phosphate ABC transporter permease [Clostridium perfringens ATCC 13124]
Sequence
MRKVKDNILNGLVWLSAIFTIGILVIILGFIFIKGIGKINLTFLTSNYSAGGGGGILPMI
VTTLWTVLLSLAVATPIGVLGAVYLQEYAKQGKMVKFIRFATESLAGIPSIVYGLFGGIF
FVVALKMGYSILAGSLTVSIIILPVIIRTTEEALKTVPESYREASLGLGATKFQTLYKVI
LPSAMPGILSGVILSIGRIIGESAAILLTAGTVAQMPKGIFSSARTLTVQAYLVTKEKGD
IETAAAVGIVLIVIILALNISAKLIAKKFNKANY
Download sequence
Identical sequences A0A0H2YQA9 A0A133MTY6 B1BUW5 B1RBU3
WP_003460575.1.100517 WP_003460575.1.10161 WP_003460575.1.1075 WP_003460575.1.13323 WP_003460575.1.1394 WP_003460575.1.14338 WP_003460575.1.17789 WP_003460575.1.2058 WP_003460575.1.20964 WP_003460575.1.23119 WP_003460575.1.27257 WP_003460575.1.27360 WP_003460575.1.27537 WP_003460575.1.28470 WP_003460575.1.28529 WP_003460575.1.29129 WP_003460575.1.29428 WP_003460575.1.30163 WP_003460575.1.31832 WP_003460575.1.3228 WP_003460575.1.35472 WP_003460575.1.43003 WP_003460575.1.4345 WP_003460575.1.4402 WP_003460575.1.44743 WP_003460575.1.48074 WP_003460575.1.4818 WP_003460575.1.50147 WP_003460575.1.52260 WP_003460575.1.5234 WP_003460575.1.52659 WP_003460575.1.64066 WP_003460575.1.66593 WP_003460575.1.67534 WP_003460575.1.68380 WP_003460575.1.76352 WP_003460575.1.78174 WP_003460575.1.81392 WP_003460575.1.83225 WP_003460575.1.85755 WP_003460575.1.87374 WP_003460575.1.90682 WP_003460575.1.93653 WP_003460575.1.96543 WP_003460575.1.98368 WP_003460575.1.99566 195103.CPF_0620 gi|110799373|ref|YP_695073.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]