SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799426|ref|YP_696673.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799426|ref|YP_696673.1|
Domain Number 1 Region: 461-866
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7e-156
Family DNA polymerase I 0.000000000864
Further Details:      
 
Domain Number 2 Region: 1-169
Classification Level Classification E-value
Superfamily PIN domain-like 8.18e-53
Family 5' to 3' exonuclease catalytic domain 0.0000302
Further Details:      
 
Domain Number 3 Region: 170-286
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 5.23e-34
Family 5' to 3' exonuclease, C-terminal subdomain 0.00015
Further Details:      
 
Domain Number 4 Region: 302-430
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.19e-23
Family DnaQ-like 3'-5' exonuclease 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110799426|ref|YP_696673.1|
Sequence length 866
Comment DNA polymerase I [Clostridium perfringens ATCC 13124]
Sequence
MKRLLILDGNSLLNRAFYAVPLLSNSEGTHTNAIYGFTNMLFKMREDIKPDYIVCTFDKK
APTFRHLEYGDYKAGRKKMPPELAEQFPIVKEMLKLFSITTYELDGFEADDIIGSLAKVA
EGEGIEVYIMTGDKDALQLAAKDINVCITKKGVSEIEVYNYDRMVEEYGVTPTQFIDVKG
LMGDKSDNIPGVPGVGEKTAFKLIKEYGSVEAVLENIDNISGKKLKENLTEYSEQAIFSK
KLATIMTNVPIDFDLDEIKSKDDYNKDQLKALFTKLQMKSILDKLSNGEEEEPEIEVKIT
NIENSKELEELFKNINEEVYINFTYLNKEKYSTIEIDKIFINYDEKNYLINFKELVKEEE
NIKSFKEFFENEDILKNGYSIKNALTALKKLGIDFNGLAFDCELAAYLIDSSKGEYTLLS
LINNYLSKFPNVKEGEEDLVGISFMKELTLVLKKKIEEEKMERLMYDIELPLETVLSSME
SIGFKVNKNILDELSIKFKRELEETQKEIFELADEEFNINSPKQLGKILFEKLDLPVIKK
TKTGYSTNAEVLEKLKDKHPIIEKITYFRQLSKIYSTYVEGLKSVIDTDGSIHSTFNQTV
TTTGRLSSTEPNLQNIPIKYEMGREIRKVFIPKEEGDLLISADYSQIELRVLAHISGDEN
MIDAFNHHSDIHTKTASEVFKVPVEEVTPLMRSRAKAVNFGIVYGIGDFSLSQDLNISRK
EAKEYMDIYFERYPKIKEYISKVIHEAQTKGYVLTMLNRRRYIPEANSSNKIVKALGERL
AMNAPIQGTAADIIKLAMVNVYNKLKELNLNSKLILQVHDELIINVVKGELDIVKKLLKE
EMENTIKLSVPLDVDVNVGEDWYKLK
Download sequence
Identical sequences A0A0H2YRL4
gi|110799426|ref|YP_696673.1| WP_011591020.1.50147 195103.CPF_2250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]