SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799462|ref|YP_697079.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799462|ref|YP_697079.1|
Domain Number 1 Region: 84-178
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.89e-36
Family Ribosomal protein L6 0.0000407
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 9.83e-26
Family Ribosomal protein L6 0.0000809
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110799462|ref|YP_697079.1|
Sequence length 179
Comment 50S ribosomal protein L6 [Clostridium perfringens ATCC 13124]
Sequence
MSRVGKMPIAIPAGVTVTVTPENVVTVKGPKGELVKAMHKDINIAVEDAQVVVTRPSDVK
EHRALHGLTRALLNNMVVGVSQGFSKTLELNGVGYRAQLQGKKLVMNLGYSHPVEVEAVD
GVDFKLDGTTKVIVEGIDKEKVGAVAANIRSWRKPEPYKGKGIKYSDEVIRRKEGKTGK
Download sequence
Identical sequences A0A140GTH7 B1BMJ3 B1BQP8 B1RBP4 B1V774 Q0SQF9 Q0TMR1 Q8XHT8
gi|110799462|ref|YP_697079.1| 195102.CPE2390 195103.CPF_2699 289380.CPR_2384 gi|110801640|ref|YP_699648.1| WP_003454268.1.100517 WP_003454268.1.10161 WP_003454268.1.1075 WP_003454268.1.13323 WP_003454268.1.1394 WP_003454268.1.14338 WP_003454268.1.17789 WP_003454268.1.2058 WP_003454268.1.20964 WP_003454268.1.22226 WP_003454268.1.23119 WP_003454268.1.24595 WP_003454268.1.27257 WP_003454268.1.27360 WP_003454268.1.27537 WP_003454268.1.28470 WP_003454268.1.28529 WP_003454268.1.29129 WP_003454268.1.29428 WP_003454268.1.30163 WP_003454268.1.31832 WP_003454268.1.3228 WP_003454268.1.32463 WP_003454268.1.39851 WP_003454268.1.43003 WP_003454268.1.4345 WP_003454268.1.4402 WP_003454268.1.44743 WP_003454268.1.48074 WP_003454268.1.4818 WP_003454268.1.50147 WP_003454268.1.50713 WP_003454268.1.51349 WP_003454268.1.52260 WP_003454268.1.5234 WP_003454268.1.52659 WP_003454268.1.5667 WP_003454268.1.64066 WP_003454268.1.66593 WP_003454268.1.67534 WP_003454268.1.68380 WP_003454268.1.76352 WP_003454268.1.78174 WP_003454268.1.81392 WP_003454268.1.83225 WP_003454268.1.85755 WP_003454268.1.87374 WP_003454268.1.90682 WP_003454268.1.93653 WP_003454268.1.96543 WP_003454268.1.99566 gi|18311372|ref|NP_563306.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]