SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799467|ref|YP_697306.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799467|ref|YP_697306.1|
Domain Number 1 Region: 3-194,355-411
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-48
Family HI0933 N-terminal domain-like 0.00017
Further Details:      
 
Domain Number 2 Region: 195-358
Classification Level Classification E-value
Superfamily HI0933 insert domain-like 3.01e-40
Family HI0933 insert domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110799467|ref|YP_697306.1|
Sequence length 415
Comment hypothetical protein CPF_2952 [Clostridium perfringens ATCC 13124]
Sequence
MIYHDVVIIGGGASGMTAAITAKNFGLDVAIVEGTDRIGKKILTTGNGRCNITNSLISFP
FENFHSANDGFFIKSLNKFSVEDTKAFFLNLGLPIIELEKGKNYPQSLQASSVVDILKMA
LEEREIPVYNSYKVKSIHKSKGKFTLSTGNEDSPVIKCKKLIMACGGKSAPKTGSDGSGY
TLAKSLGHSIIEPNPAIVQLKLSHNKLKALSGIKFNGYAEVLCDGKSIRKEFGEILFTDY
GISGPPILQISREASLGCFKGKEVKILVDMMPDKSLKELEDFLEGHFAVFSCREVINSLI
GVVNKKMIPILLREAGIDNLHKPCYELTWKEKKALINLMKSWEFKCIGTNGFQAAQVTTG
GINTKEVDSETLQSKLVDNLYFCGELLDVDGDCGGFNLQWAWSSGFTAALSCTLQ
Download sequence
Identical sequences A0A0H2YR61 A0A1U9VC06 B1R6C6
gi|110799467|ref|YP_697306.1| WP_003456905.1.10161 WP_003456905.1.2058 WP_003456905.1.20964 WP_003456905.1.27537 WP_003456905.1.30163 WP_003456905.1.50147 WP_003456905.1.52260 WP_003456905.1.5234 WP_003456905.1.52659 WP_003456905.1.68380 195103.CPF_2952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]