SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799475|ref|YP_695288.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799475|ref|YP_695288.1|
Domain Number 1 Region: 181-329
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.22e-28
Family Histidine kinase 0.0073
Further Details:      
 
Weak hits

Sequence:  gi|110799475|ref|YP_695288.1|
Domain Number - Region: 116-172
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000155
Family Homodimeric domain of signal transducing histidine kinase 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799475|ref|YP_695288.1|
Sequence length 336
Comment sensor histidine kinase [Clostridium perfringens ATCC 13124]
Sequence
MKLRDYFEEKIFFLIVNFIIFATIAVLLFIGNVGSGIIFLIGCFWFIPLFTYIILDFYKS
KKFYDNISITLDKLDRKYLLPEVIEEPNFYHGKFLYEVLKETDKDMHEHVKKYILEQKEY
REYIETWVHEIKTPIASTRLILENNESESSENIKKEIKKIEEYIDQALYYARSTDVSKDY
IVKEFSLGKSVRNVIKKNSRDFINKRIAIYLEDLDYKVYSDEKWVEFIINQVINNSIKYS
SKNSRVKIFANKSKNSITLKIKDSGVGIPNKDLGRVFEKGFTGENGRRFTKSTGMGLYLC
KNLCDKLGLGLKITSKENEGTEVSIIFPIGDAIIAN
Download sequence
Identical sequences A0A0H2YRQ6
WP_011590394.1.50147 195103.CPF_0837 gi|110799475|ref|YP_695288.1| IDP04236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]