SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799485|ref|YP_696597.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799485|ref|YP_696597.1|
Domain Number 1 Region: 14-427
Classification Level Classification E-value
Superfamily Clc chloride channel 5.36e-106
Family Clc chloride channel 0.000000817
Further Details:      
 
Domain Number 2 Region: 442-508
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.000000000405
Family TrkA C-terminal domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799485|ref|YP_696597.1|
Sequence length 519
Comment voltage-gated chloride channel family protein [Clostridium perfringens ATCC 13124]
Sequence
MDKDKEISGLNNLEFKIIVQGILVGIIVGIVIMIYKIIIGFGMEGFNKVYSYTRENPKLI
IPLFLVLIFLGFIVGIIVKKNPMIGGSGIPQVEGELSGKISVNWLRVFKDKFIGGIICMA
SGLSLGKEGPSVQIGASIGEGFAKIFKRSDFEKRLLITGGASSGLAVIFNAPLSGAIFAL
EEVHRSFSLPVMLAALSASLTGVFVDNLILGNDFCIKIPPINSLPIQYYWTLLILGAILG
VTGWIFNKGLLKTQDFYVKTLKKIPIQFKTIIPFVMVGILALTIPEAIDGGDSLIESVIG
NNIAIKLLIVILVIKFIFTFFSYSSGVPGGIFFPLLAIGALVGAIFGLLLNKYLGISDSL
IVNFIVLAMAAQFASIVKAPITGLMLITEMTGTFKHLLPVAITVTVAYLVSDMLNNKPIY
ESLLEKLLERMNIKFNTGVKKKEIFDFEVKIGSELDGKLIKDVKWPEGSLIITIFRGAEE
IIPNGEVKIQAGDVLEVIFSKEKQAQYYDEISKKTYCEI
Download sequence
Identical sequences A0A0H2YR71
WP_011590995.1.50147 195103.CPF_2173 gi|110799485|ref|YP_696597.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]