SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799529|ref|YP_696603.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799529|ref|YP_696603.1|
Domain Number 1 Region: 10-214
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 8e-59
Family MPP-like 0.0000397
Further Details:      
 
Domain Number 2 Region: 236-409
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 7.67e-28
Family MPP-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110799529|ref|YP_696603.1|
Sequence length 414
Comment M16 family peptidase [Clostridium perfringens ATCC 13124]
Sequence
MKRWTFDENTIILPNGLKVITIKKDTRLASINIGVNIGSLYEDEKELGMSHFVEHMLFKG
TKNRSNEQLNRELEFLGGDYNAYTDYISTVYSITCLDEEFEKGIELLSDMVLNSSFDEKE
MKKEKGVVLSEIKSDKDDIEDLSISRTHEYAFDKSALRNSIAGTEEHVKGFKRKQVYDFY
KKYYTPDNCVIVTVSAFSHEQMQKIITDLFGKWEGKSHKKAKIIKEENKDIVKTTYKSQI
EQGTVTYLYAFKEVCEKDKLPLKILSYKLAESSNSILFRELREERGLAYDVYSQMDLDEN
VNTMNIFTSVREESIDEVIEVIDKAILDIKNKDINFDEDMLCMMKKTHKTGVVSTLEDCS
SLCSYVLVQSLAGKDITEFINSMEELETLTGEDIYRVCNKYLNKPTIHILKPME
Download sequence
Identical sequences A0A0H2YQM6 A0A1U9V9Y4 B1BIU0
195103.CPF_2179 WP_003451379.1.10161 WP_003451379.1.2058 WP_003451379.1.24595 WP_003451379.1.31832 WP_003451379.1.4402 WP_003451379.1.50147 WP_003451379.1.51349 gi|110799529|ref|YP_696603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]