SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799545|ref|YP_696666.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799545|ref|YP_696666.1|
Domain Number 1 Region: 449-612
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.27e-33
Family Histidine kinase 0.002
Further Details:      
 
Domain Number 2 Region: 383-459
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000294
Family Homodimeric domain of signal transducing histidine kinase 0.0036
Further Details:      
 
Domain Number 3 Region: 260-333
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000162
Family Heme-binding PAS domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110799545|ref|YP_696666.1|
Sequence length 620
Comment sensor histidine kinase [Clostridium perfringens ATCC 13124]
Sequence
MYLKLSKIRNLVNSIIFIAIILYTLYFFNPRTALYLSTIIETIVVFAITFIATTVFKFSN
KKIFKLIGIYLLLVAMFKFDILVYLIAFWGEKEILQCLNLKPIAICTVLESVYCFMIIAY
VKSIDLTIKLIVCFLTLVSLISIFFYDMSVFLVVSTVLLLIILYLLRSFKLFKNDLLNYL
KLFVLINLSLIVLDILSYSLGLESLILLGDILKISIYLIIYVWISEMLITKPYKTLHEDI
IDKNKKLKILNKKMEESNNEFKEFKKKLRDNEIYFRNFLNNAPMSIAILNNDNHRIFAVN
KRFSHELNLKSNREVINKNLFKIINIENKEEFLRTKKGEASFVTSGIEVFWELDILLQSK
GYLIISMKNITELKFSEKIKDNLRKRTLSEQIKNDFLSSISHDLKTPINVIYSSVQVQEK
FYSNENIKKVDYYNQVNKENCMTLLRLANNLIDSSKIDYDYLKPNFKIYNIVTLIEDSIG
NLAEYIKEKNLTYVFDTNEEEVYVNCDQEFIQRIILNLISNSIKHTREGGIGVEIKAKKS
KVIISFTDTGEGMDKEFIEKAFLRYSKGNKKGVKNKSTGIGLYIVKNLVELQNGTININS
IKDTGTNIRLEFSREKSCGI
Download sequence
Identical sequences A0A0H2YQP1
gi|110799545|ref|YP_696666.1| IDP04569 195103.CPF_2242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]