SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799554|ref|YP_695218.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799554|ref|YP_695218.1|
Domain Number 1 Region: 23-216,312-369
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.12e-28
Family FAD-linked reductases, N-terminal domain 0.095
Further Details:      
 
Domain Number 2 Region: 381-476
Classification Level Classification E-value
Superfamily ISP domain 1.7e-23
Family Rieske iron-sulfur protein (ISP) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110799554|ref|YP_695218.1|
Sequence length 479
Comment Rieske family iron-sulfur cluster-binding protein [Clostridium perfringens ATCC 13124]
Sequence
MKSVWSESCKFRKREALNKDIKTDVLVIGAGIAGVLTAYMLKQKGRDVVLIDAAEIASGN
TKNTTAKITSQHDLIYSKLIAEFGEEKARQYAKANELAIKKYKEIIEDKRIECDFEEKPA
YVYSLNEVDVLKEEVEAAKNLGIDAEFVQEANLPFKINGAVKFNNQAQFNPLKFLKGISN
ELVIYENTRALEIKENLVVTSGGNITANNIVVATHYPIMNAPGYYFMKMHQERSYVLALE
NTSEIDGMYIDLNKEGYSFRTYNNLLLLGGISHRTGENEEGGSYDELRKVAKRLYPKAKE
KYYWSAQDCMTIDGIPYIGRYSSETPNIYVATGFNKWGMTSSMVSAMIISDMILEKENDF
SEIFSPRRFDLSLSINNIANDLIETAKNFIAQKVYIPSSEIEHIKNGHGGIIEYNGEKVG
VYKNKEGKEFFVSTKCTHLGCQLSWNSDELTWDCPCHGSRFDYKGRLIGSPATKDLVED
Download sequence
Identical sequences A0A0H2YRX9
gi|110799554|ref|YP_695218.1| WP_011590358.1.100517 WP_011590358.1.20964 WP_011590358.1.30163 WP_011590358.1.50147 WP_011590358.1.52260 WP_011590358.1.5234 WP_011590358.1.52659 WP_011590358.1.68380 195103.CPF_0767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]