SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799571|ref|YP_694635.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799571|ref|YP_694635.1|
Domain Number 1 Region: 1-145
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 1.37e-60
Family Autoinducer-2 production protein LuxS 0.00000992
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799571|ref|YP_694635.1|
Sequence length 151
Comment S-ribosylhomocysteinase [Clostridium perfringens ATCC 13124]
Sequence
MVKVESFELDHTKVKAPYVRKAGIKIGPKGDIVSKFDLRFVQPNKELLSDKGMHTLEHFL
AGFMREKLDDVIDISPMGCKTGFYLTSFGDINVKDIIEALEYSLSKVLEQEEIPAANELQ
CGSAKLHSLELAKSHAKQVLENGISDKFYVE
Download sequence
Identical sequences Q0TUQ5
gi|110799571|ref|YP_694635.1| WP_011590095.1.50147 IDP04226 195103.CPF_0171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]