SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799577|ref|YP_696097.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799577|ref|YP_696097.1|
Domain Number 1 Region: 523-771
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 3.26e-70
Family MPP-like 0.0000405
Further Details:      
 
Domain Number 2 Region: 262-522
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 1.56e-61
Family MPP-like 0.0000124
Further Details:      
 
Domain Number 3 Region: 9-253
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 7.16e-45
Family MPP-like 0.000000103
Further Details:      
 
Domain Number 4 Region: 775-971
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 1.16e-35
Family MPP-like 0.0000859
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799577|ref|YP_696097.1|
Sequence length 973
Comment peptidase [Clostridium perfringens ATCC 13124]
Sequence
MNFKENNIYSGFKLLNIENLNEIGGVGLRFEHEKTKAKLIKILSEDDNKCFAIGFRTPPE
NSTGVPHILEHSVLCGSRKFNTKEPFVELLKGSLNTFLNAMTYPDKTIYPVASRNEKDFM
NLMDVYLDAVLYPNIYKHKEIFMQEGWHYYIENKEDELKYNGVVYNEMKGAYSSPDSILY
RKIPQTIYPDTCYALSSGGDPDEIPNLTYEEFVEFHKKYYHPSNSYIFLYGNGDTEKELE
FINEEYLKNFEYKEIDSEIKEQKSFESMKEESFTYGIAESEDLNHKSYYSLNFVIGDATD
GEKGLAFDVLAYLLTRSTAAPLKKALIDAGIGKAVSGDFDNSTKQSAFTVLVKNAELNKE
EEFKKVVMDTLKDLVENGIDKELIEASINRVEFELREGDYGSYPNGLIYYLKVMDSWLYD
GDPYVHLEYEKNLEKIKSALTSNYFEDLIEKYMINNTHSSLVSLHPEKGINEKKSAELKK
KLEEIKNSFDEKTLNEIIDNCKKLKERQSTPDKKEDLESIPMLSLEDIDKEATKIPTEEK
EIDGITTLHHDFHTNKIDYVNFFFNTNSVPEDLIPYVGLLCDILGKCGTENYDYSKLSNA
INISTGGISFGAITFANLKKNNEFRPYLEISYKALSSKTNKAIELVDEIVNHTDLDDMDR
IMQIIREKRARLEGAIFDSGHRIAMKKVLSYSTNRGAYDEKISGLDYYDFLVNIEKEDKK
SKISDSLKKVRDLIFNKGNMLISYSGKEEEYENFKEKVKYLISKTNNNDFEKEEYNFELG
KKNEGLLTQGNVQYVAKGGNYKTHGYKYSGALSLLESILGFDYLWNAVRVKGGAYGVFSN
FRRDGGAYIVSYRDPNIKSTLEAYDNIPKYLNDFEADEREMTKYIIGTIRKYDQPISNGI
KGDIAVSYYLSNFTYEDLQKEREEIINADVEKIKSFAPMIKDLMKEDYICVLGNEEKIKE
NKDLFNNIKSVIK
Download sequence
Identical sequences A0A0H2YRZ9
gi|110799577|ref|YP_696097.1| 195103.CPF_1656 WP_011590829.1.31832 WP_011590829.1.4402 WP_011590829.1.50147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]