SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799590|ref|YP_696880.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799590|ref|YP_696880.1|
Domain Number 1 Region: 9-352
Classification Level Classification E-value
Superfamily Release factor 5.89e-138
Family Release factor 0.00000000622
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110799590|ref|YP_696880.1|
Sequence length 360
Comment peptide chain release factor 1 [Clostridium perfringens ATCC 13124]
Sequence
MILDRLNFIENKYDELSVKISDPSIMANQKEWRKLCKEHADLEVIVNKYKEYKEATEELE
ANKEMLSEESDQEMREMINSEIKDLTERKKELEDEIQILLLPKDPNDDKNVFVEIRGGAG
GDEAALFAANLFRMYTKYAEKNRWKVELMSANETDIGGFKEVVFMIKGAGAYSKLKYESG
AHRVQRVPDTESSGRIHTSTATVAVLPEVDDVEIEINDKDIKIDVFRASGNGGQCVNTTD
SAVRITHLPSGLVVSCQDEKSQLKNKEKAMKVLRARLFEQAEAERLAGIAEDRKSQVGTG
DRSERIRTYNYPQGRVTDHRINMTLYKLDSFLEGDIDEILNALITEDQAQKMKAMGNTEF
Download sequence
Identical sequences A0A133N7A1 B1BK92 B1BRS5 B1R732 B1UYQ3 Q0SQY1 Q0TNB0 Q8XIB9
gi|110799590|ref|YP_696880.1| WP_003452315.1.100517 WP_003452315.1.10161 WP_003452315.1.1075 WP_003452315.1.13323 WP_003452315.1.1394 WP_003452315.1.14338 WP_003452315.1.17789 WP_003452315.1.2058 WP_003452315.1.20964 WP_003452315.1.22226 WP_003452315.1.23119 WP_003452315.1.24595 WP_003452315.1.27257 WP_003452315.1.27360 WP_003452315.1.27537 WP_003452315.1.28470 WP_003452315.1.28529 WP_003452315.1.29129 WP_003452315.1.29428 WP_003452315.1.30163 WP_003452315.1.31832 WP_003452315.1.3228 WP_003452315.1.32463 WP_003452315.1.35472 WP_003452315.1.39851 WP_003452315.1.43003 WP_003452315.1.4345 WP_003452315.1.4402 WP_003452315.1.44743 WP_003452315.1.48074 WP_003452315.1.4818 WP_003452315.1.50147 WP_003452315.1.50713 WP_003452315.1.51349 WP_003452315.1.52260 WP_003452315.1.5234 WP_003452315.1.52659 WP_003452315.1.5667 WP_003452315.1.64066 WP_003452315.1.66593 WP_003452315.1.67534 WP_003452315.1.68380 WP_003452315.1.76352 WP_003452315.1.78174 WP_003452315.1.81392 WP_003452315.1.83225 WP_003452315.1.85755 WP_003452315.1.87374 WP_003452315.1.90682 WP_003452315.1.93653 WP_003452315.1.96543 WP_003452315.1.98368 WP_003452315.1.99566 gi|18311184|ref|NP_563118.1| 195102.CPE2202 195103.CPF_2466 289380.CPR_2176 gi|110802815|ref|YP_699476.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]