SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799592|ref|YP_696605.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799592|ref|YP_696605.1|
Domain Number 1 Region: 330-496
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.83e-33
Family Histidine kinase 0.0018
Further Details:      
 
Domain Number 2 Region: 261-341
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.94e-18
Family Homodimeric domain of signal transducing histidine kinase 0.0008
Further Details:      
 
Domain Number 3 Region: 201-249
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000327
Family HAMP domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110799592|ref|YP_696605.1|
Sequence length 507
Comment sensor histidine kinase [Clostridium perfringens ATCC 13124]
Sequence
MKKSISKRLFIITFGIIIFLTLFTMIFQITFFQEFYYKRKSNDLSNAVLKFRALYSYDIK
NTDSLYRALSLFELENNAKIGIYSIDSTPKYVPDPANKNSEAVDLLNDIFNELYSDQDFA
KTLLNSNSGVTTEFKSRKYSTKYIVYMVPFSLNSKNDSIIIAITSFQAIEEASALIKDFY
KYIILIVIVIGLILSYVFSNLISKPLVKLNKSAKKMSAMDFSEKCDIEREDEIGNLAKTL
NFLSKNLSNALDDLKIKNKKLEEDIEKERELEKLRKDFIAGASHELKTPIGIISGYAEGI
KDGIVDHKDQGVYLDIIIDEAEKMNKLVMDMLELSKLEAGKIDLHIIDFSLTELTEEVLV
KNSVDINKNNLTVVKNYSPTEDLYVQGDDFKIEQVLTNFVTNAIKYSEPNNQIIIDIKPV
EEDKIYFSIENTGAHIPDSDINKIWTQFYRGDTSRNRGSRSTGLGLSIVKNLLQAHESEF
GVMNTENGVKFYFTLKKSKEIDEVEEI
Download sequence
Identical sequences A0A0H2YQS3 A0A1U9VBN0
IDP04331 WP_003468780.1.10161 WP_003468780.1.2058 WP_003468780.1.39851 WP_003468780.1.50147 gi|110799592|ref|YP_696605.1| 195103.CPF_2181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]