SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799618|ref|YP_695715.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799618|ref|YP_695715.1|
Domain Number 1 Region: 4-245
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.44e-51
Family ROO N-terminal domain-like 0.00000966
Further Details:      
 
Domain Number 2 Region: 602-787
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.13e-39
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0047
Further Details:      
 
Domain Number 3 Region: 256-399
Classification Level Classification E-value
Superfamily Flavoproteins 4.6e-37
Family Flavodoxin-related 0.0045
Further Details:      
 
Domain Number 4 Region: 475-685
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.6e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0045
Further Details:      
 
Domain Number 5 Region: 425-462
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00000000437
Family Rubredoxin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110799618|ref|YP_695715.1|
Sequence length 878
Comment rubredoxin/flavodoxin/oxidoreductase [Clostridium perfringens ATCC 13124]
Sequence
MNYLEVKKDIYWVGSLDPELRVFDIIMYTPYGTTYNSYVVKGSEKIAVFETVKEKCFDDY
LSKLNSLGIDPKSIDYIVVDHTEPDHAGSVEKLLELSPKAKVIGSMQAIEFLKDIVNKDF
EYIVVGDNDTISLGNKTLQFISAPFLHWPDSMYTYIPEDKALITCDSFGSHYSCEEIFND
LVPNEEEYLDALRYYYDCIFGPYKPYVLKAIDKIKDLDIELVCPGHGPILRQDPWKIINT
YKEWSTPVKPKINGDKKVTIPYVSAYGYTKELAEEIAKGIQSEHNVEVKLYDLTYSKQED
VLADIGESDGILFGSPTIVGELLPPIRILLANLNPIIHGGKYAAAFGSFGWSGEAVPRIE
ARLKELKMNIFGPGLRIKFKPSTTELKEAFEFGRDFSRTMFGEKELDYAPNNATETKEVL
TGNGKTRYWKCLVCGEIFESPVCPEVCPVCGAGKEQFIEVEMDTFEKNDTDDNFVIIGNG
AAGFYAAKTIREINSTASVKLLSSEEVSSYSRPNLSDLLNEEMNLDTFYLAKSSWYKENN
IEELLGVTVTSIDKDAKKVILKDGTEIPYTKLILANGSHNFIPPFKVKNNNEEVTLNCEN
IHEFKGIYSIKDLKDTFDVKEEMKEAKKAVVIGAGPLGLEAAWEMKLAGLDVTVVEFLPN
LMNNQLDQEGADIFRNQVSDCGITFITSEECAEIIAKDGKLTSLNLKSGKTLDADILLVS
TGIRSNIELAKETGIECNRGVIVNERMETSIKDIYACGDVAEFNGLVYGNWPAAIEMGKT
AGANACEAEKAFENFTPSIILDALNTHVFSAGLIRFNDSSYEKISSKDESKGQYTKLFFK
DNILVGGIIVGDISKAGQIIIAIDNKLSKAAALSNDLL
Download sequence
Identical sequences A0A0H2YQR7 A0A1U9V7A6
gi|110799618|ref|YP_695715.1| WP_011590640.1.10161 WP_011590640.1.2058 WP_011590640.1.50147 195103.CPF_1269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]