SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799648|ref|YP_696817.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799648|ref|YP_696817.1|
Domain Number 1 Region: 101-204
Classification Level Classification E-value
Superfamily Cell-division inhibitor MinC, C-terminal domain 1.02e-31
Family Cell-division inhibitor MinC, C-terminal domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799648|ref|YP_696817.1|
Sequence length 211
Comment septum formation inhibitor [Clostridium perfringens ATCC 13124]
Sequence
MRDDRIFIKGNKLGINAIINMDKFGNFDEMLDSLVEKLSRGKKFYKGATLTVTTDLKYIN
ERQISKLKDVLFDEILIKDCIFEERLEKQSSVFSGVYEGRTKFVRKTVRSGQCLNYAGNL
IIIGDVNNGGEVRAHGNVIVLGDLKGKVFAGDNGNENAIIAAYSLEPELISISGKITISP
DDFEKTGYPEVARLNENNIIVEPYLPDKYSY
Download sequence
Identical sequences A0A133NCQ1 B1BKF6 B1BRY6 B1R3L9 B1UYW5 Q0SR42 Q0TNH3 Q8XII0
gi|110799648|ref|YP_696817.1| 195102.CPE2139 195103.CPF_2394 289380.CPR_2106 gi|18311121|ref|NP_563055.1| WP_003452463.1.100517 WP_003452463.1.10161 WP_003452463.1.1075 WP_003452463.1.13323 WP_003452463.1.1394 WP_003452463.1.14338 WP_003452463.1.17789 WP_003452463.1.2058 WP_003452463.1.20964 WP_003452463.1.22226 WP_003452463.1.23119 WP_003452463.1.24595 WP_003452463.1.27257 WP_003452463.1.27360 WP_003452463.1.27537 WP_003452463.1.28470 WP_003452463.1.28529 WP_003452463.1.29129 WP_003452463.1.29428 WP_003452463.1.30163 WP_003452463.1.31832 WP_003452463.1.3228 WP_003452463.1.32463 WP_003452463.1.35472 WP_003452463.1.39851 WP_003452463.1.43003 WP_003452463.1.4345 WP_003452463.1.4402 WP_003452463.1.44743 WP_003452463.1.48074 WP_003452463.1.4818 WP_003452463.1.50147 WP_003452463.1.50713 WP_003452463.1.51349 WP_003452463.1.52260 WP_003452463.1.5234 WP_003452463.1.52659 WP_003452463.1.5667 WP_003452463.1.64066 WP_003452463.1.66593 WP_003452463.1.67534 WP_003452463.1.68380 WP_003452463.1.76352 WP_003452463.1.81392 WP_003452463.1.83225 WP_003452463.1.85755 WP_003452463.1.87374 WP_003452463.1.90682 WP_003452463.1.93653 WP_003452463.1.96543 WP_003452463.1.98368 WP_003452463.1.99566 gi|110801744|ref|YP_699415.1| IDP04087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]