SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799658|ref|YP_696367.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799658|ref|YP_696367.1|
Domain Number 1 Region: 289-486
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.68e-47
Family Ribonuclease PH domain 1-like 0.0000203
Further Details:      
 
Domain Number 2 Region: 6-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.87e-41
Family Ribonuclease PH domain 1-like 0.000023
Further Details:      
 
Domain Number 3 Region: 447-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.79e-25
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 4 Region: 136-228
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.03e-24
Family Ribonuclease PH domain 2-like 0.0047
Further Details:      
 
Domain Number 5 Region: 606-691
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.23e-20
Family Cold shock DNA-binding domain-like 0.00037
Further Details:      
 
Domain Number 6 Region: 551-628
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.37e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799658|ref|YP_696367.1|
Sequence length 702
Comment polynucleotide phosphorylase [Clostridium perfringens ATCC 13124]
Sequence
MNHTHETIIAGRPMKVEFGKLGMLSDAAILMSYGDTVILTNVNASEKPREGIDFFPLSVE
YEERLYSVGKIPGGFIKREGKPSEKAILNGRAIDRPLRPLFPKGYRNDVQVVCTVVSVEN
DNLPEILAINAASMALCLSSIPFTTPVAAVQVGLIGEEFILNPTSKEREESSLQLTVCAT
KERVMMIEAGGDEIPEDTMINAIKFGFDKCQDIIKFQEEAVSMFGKEKKVPELHKVPEEI
EEAVREFAFDMISESMHITDRDERNAAMDEVKAKINEEFEEKYPDNMSDIGEAVYDMQKE
VVRHMLLKEGKRPDGRAFDEVRNIGCEVGLLPRTHGTGLFTRGLTQVMTVATLGSISEIQ
ILDGIGEEESKRYMHHYNFPAYSVGEVRPLRGPGRREIGHGALAERALEPLIPSEAKFPY
TIRLVSEVLSSNGSTSQASVCGSTLALLDAGVPIKRPAAGIAMGLITSKDLTEEEVLTDI
QGLEDFFGDMDFKVAGTEEGITSIQVDTKIKGLSEKVIHDAIYGARKARLMILDKIKECI
PAPREEVSKYAPKTSTLQIDPEKIRDVIGAGGKVINKIIADTGVKIDIKEDGLVYVSSAE
SEGVKEAVKIIEGLTKEVKAGEIYLGKVTKIAQFGAFVEVLPNKEGLVHISKLDNKRVEK
VEDVVSVGDEILVKVTEIDSQGRINLSRKDAIKEAEEENKQQ
Download sequence
Identical sequences A0A1U9VAE4 B1RAI2 Q0TPS3
WP_003459742.1.10161 WP_003459742.1.2058 WP_003459742.1.20964 WP_003459742.1.27537 WP_003459742.1.30163 WP_003459742.1.43003 WP_003459742.1.50147 WP_003459742.1.52260 WP_003459742.1.5234 WP_003459742.1.52659 WP_003459742.1.68380 gi|110799658|ref|YP_696367.1| 195103.CPF_1934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]