SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799665|ref|YP_694747.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799665|ref|YP_694747.1|
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 6.93e-30
Family Holo-(acyl carrier protein) synthase ACPS 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799665|ref|YP_694747.1|
Sequence length 133
Comment 4'-phosphopantetheinyl transferase [Clostridium perfringens ATCC 13124]
Sequence
MIIGIGVDIIEIERVRQAIQNNKNFLSKLFTEREIDYFISRNMNSEVIAGNFAAKEAVSK
ALGTGIRGFSFKDIEILRNELGKPEVILHNGANLIGNKLVENNNSLRVHLSISHNNSSAI
AYSVLEGEYYGNM
Download sequence
Identical sequences Q0TUE3
195103.CPF_0287 WP_004457509.1.100517 WP_004457509.1.27257 WP_004457509.1.39851 WP_004457509.1.50147 gi|110799665|ref|YP_694747.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]