SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799743|ref|YP_695560.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799743|ref|YP_695560.1|
Domain Number 1 Region: 61-286
Classification Level Classification E-value
Superfamily MetI-like 8.24e-58
Family MetI-like 0.00021
Further Details:      
 
Domain Number 2 Region: 17-55
Classification Level Classification E-value
Superfamily MalF N-terminal region-like 0.000000288
Family MalF N-terminal region-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110799743|ref|YP_695560.1|
Sequence length 301
Comment sugar ABC transporter permease [Clostridium perfringens ATCC 13124]
Sequence
MELVKKKRRTPGTLGKYFYVFVLPALAIYLIFSIVPFLYTIFYSFTNYTDINPINLSFVG
FENYAKVFSTPVMMTGIKNSVIYAIALTGLQTVLALPLAVLLDKKLKSRNLLRAVFFFPA
VFSSLIIGYLWNFILSSSDYGLVNNILHSLGLDTINFFTTNKALFSVIFTQAWQWTGWAM
VIFLANLQSIPKELYEAASIDGAGSLKQFFHVTLPLMCPSVKIIVVTGLIGGMKVFDIIY
SMTSGGPGNATETVMTVMMKKGISDGFYSTGAAFGVLFFIIVLVISGITTKLMGKWSESI
S
Download sequence
Identical sequences A0A0H2YSD5 A0A127EHC4 B1BJF4 B1BTJ6 B1V277
195103.CPF_1114 WP_003451894.1.10161 WP_003451894.1.1075 WP_003451894.1.13323 WP_003451894.1.1394 WP_003451894.1.14338 WP_003451894.1.17789 WP_003451894.1.2058 WP_003451894.1.20964 WP_003451894.1.24595 WP_003451894.1.27257 WP_003451894.1.27360 WP_003451894.1.28470 WP_003451894.1.28529 WP_003451894.1.29129 WP_003451894.1.29428 WP_003451894.1.30163 WP_003451894.1.3228 WP_003451894.1.39851 WP_003451894.1.43003 WP_003451894.1.4345 WP_003451894.1.44743 WP_003451894.1.48074 WP_003451894.1.4818 WP_003451894.1.50147 WP_003451894.1.50713 WP_003451894.1.52260 WP_003451894.1.5234 WP_003451894.1.52659 WP_003451894.1.64066 WP_003451894.1.66593 WP_003451894.1.67534 WP_003451894.1.68380 WP_003451894.1.76352 WP_003451894.1.78174 WP_003451894.1.81392 WP_003451894.1.83225 WP_003451894.1.85755 WP_003451894.1.87374 WP_003451894.1.90682 WP_003451894.1.93653 WP_003451894.1.96543 WP_003451894.1.99566 gi|110799743|ref|YP_695560.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]