SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799761|ref|YP_696483.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799761|ref|YP_696483.1|
Domain Number 1 Region: 2-154,296-346
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.26e-29
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110799761|ref|YP_696483.1|
Sequence length 425
Comment FAD dependent oxidoreductase [Clostridium perfringens ATCC 13124]
Sequence
MKVVVIGGGWSGVAAAIEAKKMGADVVLFEKTDLLLGLGNVGGIMRNNGRYTASQELIAM
GGGDLINITDKVSRHKDIPFPGHEHAWLYDVNLVEGEVKRYVESLGIETKMVSRIIDIKQ
EDNKILGVYTSDGQYYKGDVFIETTGSTGPMGNCLRYGNGCSMCILRCPSFGPRISISSR
CGVEDIQGERVGDELGAFSGSCKLAKETLSEEIRKELEEKGCVVLKIPKEDVNYDKLNTK
VCQQYALKEFAENVVLLDTGHAKLMTTYYPLEKLRKIKGLENAKYVDPYAGGKGNSIRYL
SVAPRDDNMKVKGVTNLFCAGEKSGLFVGHTEAIVTGTLAGHNAVRHALGIPYLILPRAT
VLGDIIAFANEESQSREGKKNRYTFAGSVYFNRMKELGLYTIDKDEIQKRVAQLNLDGVF
SKKLM
Download sequence
Identical sequences A0A0H2YR60
WP_011590960.1.50147 gi|110799761|ref|YP_696483.1| 195103.CPF_2054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]