SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799765|ref|YP_694661.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799765|ref|YP_694661.1|
Domain Number 1 Region: 591-761
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.1e-43
Family Histidine kinase 0.00058
Further Details:      
 
Domain Number 2 Region: 519-602
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.16e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0031
Further Details:      
 
Domain Number 3 Region: 388-463
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000018
Family Heme-binding PAS domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799765|ref|YP_694661.1|
Sequence length 791
Comment sensory box histidine kinase [Clostridium perfringens ATCC 13124]
Sequence
MDNPIFFHIFNDDKNKLETQRIIKLSIFIVFSIFFILLIDLSYKVLIRKNIEFIPGNSMP
SFSLSLSLILGTMAYISSLIYYSSTKKDDFFIISLIYMNLSVELLITKGHNLIIFDKFIF
IHAIFRIILLFYVAFNKKGISPLITKHKIITSIVVFLFSVITPMINYRIFSNNLFAKDIY
FYATLMTMIIILYIIACIFLSKKSLDDCELIYSFIIASILLIALRGLYWICEVLLPNITL
LKTNNVVLLLTILSFLLAISGVFNEITAKNKRSSLLQNELQVFYHLVEFNTSSSIILYDN
KKKVIYTNKTIRERYCKSTKLKDQLKEVEKLFVDSIFIDDSEKNATKALFNKGNWEGKLI
LKNGKIVSAYIQILNVENKNYFAVNLKDITEEYTLTKNIKRNEQLLSCINNNVQDLIISV
DNNGLITYVNDSVLKTLNYTYEEIIGMPIINLLGKNDEILNQLKLEDEEDSIKCKLVGKH
SFVYVESIIRTLNDNNEIPYGKVIVAKNLTSKKRLENLAIKFKEAKAYEQIRNEFFANIS
HELRTPLNIIYSTIQLLNSKHETDPMDFNNFYDKYKQGLKINCYRMLRLINNLIDVSKIE
VGFLKADFTNRDIVFLVENIVSLVIPHSENKDINIIFDTNVEENIIKCDPVKIERLILNL
LSNAIKFTQNHGEIFVDLNISKDWVKISIKDNGIGIPKEMQASIFDRFVQADKSLKRRNE
GSGIGLSIVKSIAELHDGKIELISDGIKGSEFIVWLPNVKLNYTEESNNLVDYITDDKNI
ELELSDIYEVH
Download sequence
Identical sequences A0A0H2YQW9 A0A174H197 B1R8B7
IDP04227 gi|110799765|ref|YP_694661.1| 195103.CPF_0198 WP_003458291.1.100517 WP_003458291.1.10161 WP_003458291.1.2058 WP_003458291.1.20964 WP_003458291.1.22226 WP_003458291.1.27537 WP_003458291.1.30163 WP_003458291.1.31832 WP_003458291.1.43003 WP_003458291.1.4402 WP_003458291.1.50147 WP_003458291.1.52260 WP_003458291.1.5234 WP_003458291.1.52659 WP_003458291.1.68380 WP_003458291.1.81392 WP_003458291.1.98368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]