SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799770|ref|YP_695110.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799770|ref|YP_695110.1|
Domain Number 1 Region: 7-224,413-625
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.24e-141
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000212
Further Details:      
 
Domain Number 2 Region: 224-412
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 1.47e-55
Family ValRS/IleRS/LeuRS editing domain 0.00000182
Further Details:      
 
Domain Number 3 Region: 621-816
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.07e-35
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799770|ref|YP_695110.1|
Sequence length 816
Comment leucyl-tRNA synthetase [Clostridium perfringens ATCC 13124]
Sequence
MGNYSTAIDKKWQEKWAESGLYKFDPNKEGEKLYVLEMFSYPSGSQLHAGHWFNYGPVDS
WARFKRMQGYNVFQPMGFDAFGLPAENFAIKTGIHPQDSTIKNIAKMEEQLKAMGAMFNW
ENEVVTCSPEYYKWTQWLFLKLYEKGLAYRKKAPVNWCPSCQTVLANEQVVDGACERCST
EVTKKDLTQWFFKITDYADELLDKLDDLDWPEKTVSMQKHWIGRSTGSQVNFKVKDSDLN
FDVFTTRVDTLCGVSYVVLAPENPLVDEIVSAEQKEAVENYKEEAKKQSDIERQSISREK
TGVFTGAYAIHPLTGKEVPIWVGDYVLATYGTGAVMAVPAHDERDFAFAEKFNLPINRVI
EAKDGSETNLPFCEHGILVNSGEFDGLTTDEAKEKIVEKLASMGLGEKKVNFRLRDWLVS
RQRYWGAPIPVVYCEECGIVPVPESQLPVELPYDVEFAPDGKSPLAKSEAFVNTTCPHCG
KPAKRETDTLDTFVCSSWYYLRYPDNKNTEAPFNPELINKMLPVDKYVGGPEHACMHLLY
ARFITKALRDMGYLNFDEPFTSLTHQGLILGPDGLKMSKSKGNTISPDDYIKEYGADVFR
MYLMFGFAYTEGGAWSDDGIKSVNRFVERIERIIDTAREAISKGENNKTTMDKAEKELNY
WRHNTIKSVTDDTDKLQFNTAIARMMEFINALSKYTQEKEMNLDFLKDVVSDYLRLLAPF
APHFSEEQWSLLGNSYSIFNEAWPKFDPKALVKDEVEIAIQVNGKIKNKIMVSSDLDEEG
IKAAALADEKIIASTEGKTVVKVIVIKGRLVNIVVK
Download sequence
Identical sequences B1R6M3 Q0TTD0
WP_003457020.1.23119 WP_003457020.1.27537 WP_003457020.1.50147 gi|110799770|ref|YP_695110.1| 195103.CPF_0657 NYSGRC-FDAO-ABG83404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]