SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799776|ref|YP_696913.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799776|ref|YP_696913.1|
Domain Number 1 Region: 7-169,247-319
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.37e-36
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.04
Further Details:      
 
Domain Number 2 Region: 153-250
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000427
Family FAD/NAD-linked reductases, N-terminal and central domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799776|ref|YP_696913.1|
Sequence length 320
Comment pyridine nucleotide-disulfide family oxidoreductase [Clostridium perfringens ATCC 13124]
Sequence
MENILCEYDVVVVGGGISGMAAAIRSKENGIGKVLLLEREDVLGGVLNHCIHCGFGKEIL
GEAVTGSEFVEYLVDKVHKLGIDVKLNTTVLEISKDKEISYVNPDEGMKKMKTRAIVLST
GSREKFKGNVSVPLNKFTGIYTSGTAHRFINLYGYLPGKKIVIIGSHDSDMIVARRLIIE
GAKVEAIIESKDYLNSSQYIVENIIEAFDIPVKLGYTVNEVLGTERVEGVIISKGGEEES
FIKCDSLLISVPWIPESALGKKMGLRISNSSETILVNENFETSEGGIFACGNVLHAYELS
DLATKEGFKVGDAIKEYLEN
Download sequence
Identical sequences A0A0H2YR67 B1R764
gi|110799776|ref|YP_696913.1| WP_003457394.1.27537 WP_003457394.1.50147 195103.CPF_2499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]