SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799811|ref|YP_695503.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799811|ref|YP_695503.1|
Domain Number 1 Region: 250-415
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.38e-38
Family Histidine kinase 0.003
Further Details:      
 
Domain Number 2 Region: 178-257
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.73e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799811|ref|YP_695503.1|
Sequence length 418
Comment sensor histidine kinase [Clostridium perfringens ATCC 13124]
Sequence
MSKKNKPKNVTSIAIKINAISVRDLFFRFLAIDICLIIILIILWCIQAEKDFYGELVKNA
QRSFNFFPIENSTYTVVWSNGKTMVKEAGAFLYYVRKIVIILGIVEGVFLLEEIIFGTAK
IRKTLKPLNEIAETASRLSNMDFDEEKFQSLEDAISKISPVTSDERIHIGDSELKGLEDA
INKLLDRMRDSYRQQARFVSDASHELRTPISVIQGYANMLDRWGKNDESVLEESIIAIKS
ESENMKNLVEQLLFLARGINGKTKLTIKEFSLNNMIDEVFEESKMIDKNHVYNYIESEHI
TVQGDMALLKQTARILVENATKYTEEGEIITLKVGENSKGEAYFSIQDNGIGMDENDVPH
IFERFFRADTARVRKNGGTGLGLSIAKWIIDNHKGYFSVLSRKGIGTRITVYLPQNIK
Download sequence
Identical sequences A0A0H2YRY8 B1R9S0
WP_003459145.1.27537 WP_003459145.1.50147 IDP04239 NYSGRC-FDAO-ABG83445 195103.CPF_1057 gi|110799811|ref|YP_695503.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]