SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799883|ref|YP_696076.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799883|ref|YP_696076.1|
Domain Number 1 Region: 44-287
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 2.09e-87
Family Creatinase/aminopeptidase 0.000000464
Further Details:      
 
Domain Number 2 Region: 3-24
Classification Level Classification E-value
Superfamily Sec-C motif 0.0000000213
Family Sec-C motif 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110799883|ref|YP_696076.1|
Sequence length 289
Comment methionine aminopeptidase [Clostridium perfringens ATCC 13124]
Sequence
MRINRNDLCWCNSGKKYKKCHMEFDERIENLAREGFEVPTRDIIKNEEQIEGIRKSAEIN
NAVLDLVAEKIKAGMSTEDINKIVHDYTVSRGAIPAPLNYGGFPKSVCTSINDEVCHGIP
DENIILKEGDIINVDVSTIYNGYYSDASRMFIIGEASENAKRLVKVAKECLEKGIEAVKP
WGFLGDIGAAIQEHAEKNGYSVVRDFGGHGVGLKFHEDPFVYHYGDAGEGMVLVPGMIFT
IEPMINEGKYDVFVDAENDWTALTMDGSLSAQWEHTILVTEDGIEIIAK
Download sequence
Identical sequences A0A0H2YSR8 A0A127EIX1 B1BXM9
gi|110799883|ref|YP_696076.1| WP_003466212.1.10161 WP_003466212.1.1075 WP_003466212.1.13323 WP_003466212.1.1394 WP_003466212.1.14338 WP_003466212.1.17789 WP_003466212.1.2058 WP_003466212.1.20964 WP_003466212.1.22226 WP_003466212.1.27257 WP_003466212.1.27360 WP_003466212.1.27537 WP_003466212.1.28470 WP_003466212.1.28529 WP_003466212.1.29129 WP_003466212.1.29428 WP_003466212.1.30163 WP_003466212.1.31832 WP_003466212.1.3228 WP_003466212.1.39851 WP_003466212.1.43003 WP_003466212.1.4345 WP_003466212.1.4402 WP_003466212.1.44743 WP_003466212.1.48074 WP_003466212.1.4818 WP_003466212.1.50147 WP_003466212.1.52260 WP_003466212.1.5234 WP_003466212.1.52659 WP_003466212.1.5667 WP_003466212.1.64066 WP_003466212.1.66593 WP_003466212.1.67534 WP_003466212.1.68380 WP_003466212.1.76352 WP_003466212.1.78174 WP_003466212.1.81392 WP_003466212.1.83225 WP_003466212.1.85755 WP_003466212.1.87374 WP_003466212.1.90682 WP_003466212.1.93653 WP_003466212.1.96543 WP_003466212.1.98368 WP_003466212.1.99566 195103.CPF_1635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]