SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799890|ref|YP_697294.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799890|ref|YP_697294.1|
Domain Number 1 Region: 145-165
Classification Level Classification E-value
Superfamily Sec-C motif 0.0000000213
Family Sec-C motif 0.0011
Further Details:      
 
Weak hits

Sequence:  gi|110799890|ref|YP_697294.1|
Domain Number - Region: 24-69
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00932
Family Tetracyclin repressor-like, N-terminal domain 0.082
Further Details:      
 
Domain Number - Region: 64-117
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0144
Family AF0587 pre C-terminal domain-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110799890|ref|YP_697294.1|
Sequence length 166
Comment hypothetical protein CPF_2930 [Clostridium perfringens ATCC 13124]
Sequence
MSLYKQWTDMVVEYVKVKGEAAFWKEYSDVETKIYKDLLANHKEVKKATIADLAKEYGTT
EEFVMGFVDGINDSLKTPYDLEKVESNTELSFDIDFENLYYNMLDAKADYLFNLPQWDAI
FSGEKRREIQFRYRDSKTVRNEEVKVGRNEPCPCGSGKKYKKCCGK
Download sequence
Identical sequences A0A0H2YSS1 A0A140GU26 B1BET3 B1BXB7 B1R6B6 B1V613 Q0SPU7 Q8XH82
gi|18311585|ref|NP_563519.1| gi|110802904|ref|YP_699860.1| WP_003456869.1.100517 WP_003456869.1.10161 WP_003456869.1.1075 WP_003456869.1.13323 WP_003456869.1.1394 WP_003456869.1.14338 WP_003456869.1.17789 WP_003456869.1.2058 WP_003456869.1.20964 WP_003456869.1.22226 WP_003456869.1.23119 WP_003456869.1.24595 WP_003456869.1.27257 WP_003456869.1.27360 WP_003456869.1.27537 WP_003456869.1.28470 WP_003456869.1.28529 WP_003456869.1.29129 WP_003456869.1.29428 WP_003456869.1.30163 WP_003456869.1.31832 WP_003456869.1.3228 WP_003456869.1.32463 WP_003456869.1.39851 WP_003456869.1.43003 WP_003456869.1.4345 WP_003456869.1.4402 WP_003456869.1.44743 WP_003456869.1.48074 WP_003456869.1.4818 WP_003456869.1.50147 WP_003456869.1.50713 WP_003456869.1.51349 WP_003456869.1.52260 WP_003456869.1.5234 WP_003456869.1.52659 WP_003456869.1.5667 WP_003456869.1.64066 WP_003456869.1.66593 WP_003456869.1.67534 WP_003456869.1.68380 WP_003456869.1.76352 WP_003456869.1.78174 WP_003456869.1.81392 WP_003456869.1.83225 WP_003456869.1.85755 WP_003456869.1.87374 WP_003456869.1.90682 WP_003456869.1.93653 WP_003456869.1.96543 WP_003456869.1.98368 WP_003456869.1.99566 195102.CPE2603 195103.CPF_2930 289380.CPR_2613 gi|110799890|ref|YP_697294.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]