SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799893|ref|YP_695149.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799893|ref|YP_695149.1|
Domain Number 1 Region: 1-361
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.66e-95
Family FMN-linked oxidoreductases 0.0000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110799893|ref|YP_695149.1|
Sequence length 368
Comment FAD/FMN-binding oxidoreductase [Clostridium perfringens ATCC 13124]
Sequence
MKTLFDKTNLGTINMKNRFLRGALWTALADEKGHMTNELSDVYEELARGGVGTIVTGYAF
VTENEQPNPRMMGIYDDSFIPEYKEFTDKIHRLGSNIIMQIVYGGFMTEFNVGERVIWGP
STTKNEVTGTLSREMTKEDIKYLVNAYAEAALRVKKSGFDGVEIHGGHGYLVSQFLSPYY
NKRTDEYGGSIENRGRFVFEIFKAIREKVGEKFPILIKLNSSDYVKEGGLTIEDSLYVAE
RLAELGIDAIEVTGGNESIEEVMKNNLGPSRTKVAISKDRESYFKEYAIKLAERINKPVI
LSGGNRHFDVMEELLNDTNIEYFSLSRPLTAEPDLINKWYSGDLKKPKCKSCNQCYKTYG
KRCIFNIK
Download sequence
Identical sequences A0A0H2YS78 A0A174DJ03 B1UZB7
195103.CPF_0697 gi|110799893|ref|YP_695149.1| NYSGXRC-11106g WP_004459980.1.10161 WP_004459980.1.2058 WP_004459980.1.50147 WP_004459980.1.50713 WP_004459980.1.81392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]