SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799898|ref|YP_695659.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799898|ref|YP_695659.1|
Domain Number 1 Region: 722-886
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.64e-40
Family Histidine kinase 0.0019
Further Details:      
 
Domain Number 2 Region: 661-734
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000314
Family Homodimeric domain of signal transducing histidine kinase 0.0016
Further Details:      
 
Domain Number 3 Region: 249-373
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000157
Family Universal stress protein-like 0.04
Further Details:      
 
Domain Number 4 Region: 34-121
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000301
Family RecA protein-like (ATPase-domain) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110799898|ref|YP_695659.1|
Sequence length 900
Comment sensor histidine kinase KdpD [Clostridium perfringens ATCC 13124]
Sequence
MRETRPNPQEILKEINKNEKDSKRGKLKIFFGYAAGVGKTYAMLEAAHSAIAMGLDVVVG
YIEPHTRPETLALLEGLELLPNLEVAYRGLVLREFNLDLALSRKPDLIIVDELAHTNVKG
LRHEKRYSDIEELLDAGIDVYTTLNVQHIESLNDVVASITNIVVKERIPDRIFKNAFQIE
LIDVDPSVLIERLNSGKIYVKNQAKKALKNFFIRENLVALRELALRETANSVNKEVMINK
NENFYHTNEHILVCLSSSPSNSKVIRTSARMAEAFHGKFTALFVETTSSRELKEGNIERL
REHVKLAKDLGAKIETVYGDDVAYQVSEFSKISSVSKVIIGRTKKKRHLWSRFGIVDRLI
ELAPELDVYIIPDEEENVEDINKICLNKEKITIKDSLKTLGILIITIIISLFFENLGFSE
ANIIIVFILGVLIIAKETYGRIYGVISSLFSVLLFNFFFTEPKFTFNAYDSSYIFTFFIM
LVSALITSTLTNKVKVQANKSAITAYRTNILLESSSELGRCSDLEEIILKSQEQVSRLVK
KPVVVYKAKNSQIENIYNYKFKDGSELSDKYINLDEQGVVLWVINNRKYAGKGTETLPGA
KAMYIPVLGQEDIGIVIGIILEEGEELEEGEKSLLIAMINQVSFVIDNYILEEAKKQALM
QAENEKFKANLLRAVSHDLRTPLTSISGSASLLLNNNFDEETKRKLTLDIYDDSIWLINL
VENLLSVSRIDNGNINLNREAQLVEEIILEALQHVNRNACDYNIEIDLKDELLMVNADVR
LIIQVIINIVDNAIKYTEKGSNIKISAFSKGDNVIIEIADNGVGISKEDKEHIFDMFFTS
KKNISDSRRGLGLGLALCKSIINVHEGEIYVRDNKPRGTIIGFSLQRFEVNNNETSNFSY
Download sequence
Identical sequences A0A0H2YRI1 A0A1U9V891 B1R5J9
195103.CPF_1213 WP_003456245.1.10161 WP_003456245.1.2058 WP_003456245.1.20964 WP_003456245.1.23119 WP_003456245.1.27537 WP_003456245.1.30163 WP_003456245.1.50147 WP_003456245.1.52260 WP_003456245.1.5234 WP_003456245.1.52659 WP_003456245.1.68380 gi|110799898|ref|YP_695659.1| GO.3953 IDP04351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]