SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799910|ref|YP_694486.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799910|ref|YP_694486.1|
Domain Number 1 Region: 3-75
Classification Level Classification E-value
Superfamily CPE0013-like 6.93e-24
Family CPE0013-like 0.00000932
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799910|ref|YP_694486.1|
Sequence length 77
Comment hypothetical protein CPF_0013 [Clostridium perfringens ATCC 13124]
Sequence
MHKDIFTSVVRVRGSKKYNVVPVKSNKPVEISKWIDFSNVLSRLYVGVPTKSGNVVCKNI
MNTGVDIICTKNLPKDS
Download sequence
Identical sequences A0A0H2YRJ2 A0A133N035 B1BHX7 B1BTI4 B1R808 B1V2U0 Q0SWX0 Q8XPF0
195102.CPE0013 195103.CPF_0013 289380.CPR_0013 WP_003450903.1.100517 WP_003450903.1.10161 WP_003450903.1.2058 WP_003450903.1.20964 WP_003450903.1.22226 WP_003450903.1.23119 WP_003450903.1.24595 WP_003450903.1.27257 WP_003450903.1.27537 WP_003450903.1.30163 WP_003450903.1.31832 WP_003450903.1.32463 WP_003450903.1.35472 WP_003450903.1.39851 WP_003450903.1.43003 WP_003450903.1.4402 WP_003450903.1.50147 WP_003450903.1.50713 WP_003450903.1.51349 WP_003450903.1.52260 WP_003450903.1.5234 WP_003450903.1.52659 WP_003450903.1.5667 WP_003450903.1.68380 WP_003450903.1.81392 WP_003450903.1.90682 WP_003450903.1.98368 gi|18308995|ref|NP_560929.1| 000002079|e2jovA1|4328.1.1.1|A:1-77 d2jova1 CpR31 gi|110803928|ref|YP_697362.1| gi|110799910|ref|YP_694486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]