SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799945|ref|YP_696101.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799945|ref|YP_696101.1|
Domain Number 1 Region: 13-431
Classification Level Classification E-value
Superfamily Clc chloride channel 3.14e-106
Family Clc chloride channel 0.000000804
Further Details:      
 
Domain Number 2 Region: 437-515
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.00000000000942
Family TrkA C-terminal domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110799945|ref|YP_696101.1|
Sequence length 523
Comment voltage-gated chloride channel family protein [Clostridium perfringens ATCC 13124]
Sequence
MSNESTKKVLSHRKDLRFKLVLEGAAIGLLCSLVLVLNRIIVNYLFPLFKKLYAWAALSI
TNMIIVLVILAILGALVGFMVRREPMISGSGIPQVEGELIGKLKMNWLKILIYKFLGGVI
SLGAGLSLGREGPSVQMGAAVGEGFSNGLKRINIEKKYLITSGASAGLAAAFNAPLSGVI
FALEEVHKSFSPLVLVSAMAASLVSDFVSKQFLGMNPSLGIENVPVLPLKYYWVLIILGV
ILGIGGAIFSKGILKVQSLYGKFKNVPVEVKVMIPFLLTGILGIFAPIILGGGHELIMDL
ATKSFPIKLLLAVLLVKFLLTIISFGAGTPGGIFFPLLLLGAVVGNIVGIVSCNAFGVPN
QYIIDFIILAMAGNFASIVKAPITGIILITEMTGSFEHMLALSVVVIISYVTSDLLKSEP
IYESLLERWIEKVGSEVEEPSNNKTLLEVGVELGSEAEGKEIKDVNWPETALLVAIKRGN
NEIIPKGSIEIQSGDYLVVMVDESRASSVLEEIQFLTSAKEEI
Download sequence
Identical sequences A0A0H2YRE7 A0A173ZZ56 B1BNA1 B1V5V5
195103.CPF_1662 gi|110799945|ref|YP_696101.1| WP_003475779.1.100517 WP_003475779.1.10161 WP_003475779.1.2058 WP_003475779.1.24595 WP_003475779.1.43003 WP_003475779.1.50147 WP_003475779.1.50713 WP_003475779.1.81392 WP_003475779.1.98368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]