SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799954|ref|YP_696649.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799954|ref|YP_696649.1|
Domain Number 1 Region: 5-257
Classification Level Classification E-value
Superfamily MetI-like 8.78e-52
Family MetI-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110799954|ref|YP_696649.1|
Sequence length 266
Comment spermidine/putrescine ABC transporter permease PotC [Clostridium perfringens ATCC 13124]
Sequence
MVKKLGDFISKFYLALVFIFLYAPIVTLMVFSFNKTKSMAVWGGFTFDWYSSLLENDRII
AALYYTVLIAVIASVVATVIGTISAIGINNMKKGPRTLLLNVNYLPVLNPDIVTGISLMT
LFAIGGVLFNLKPGFWTMLLAHITFDIPYVILSVLPKLRQLPPNLTDAALDLGAKPSYAL
RKVVIPQIIPGIAAGFLIAFTMSIDDFVISFFTTGPGVSNLSIEIYSMARRGISPEINAL
STLMFIVVLALLLIANRKQSLVKGER
Download sequence
Identical sequences A0A0H2YRM1 A0A133N4K5 B1BIP3 B1BPV8
WP_003451178.1.100517 WP_003451178.1.10161 WP_003451178.1.2058 WP_003451178.1.23119 WP_003451178.1.24595 WP_003451178.1.35472 WP_003451178.1.43003 WP_003451178.1.50147 WP_003451178.1.5667 WP_003451178.1.90682 195103.CPF_2225 gi|110799954|ref|YP_696649.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]