SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799968|ref|YP_697239.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799968|ref|YP_697239.1|
Domain Number 1 Region: 3-221,315-361
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.97e-44
Family FAD-linked reductases, N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110799968|ref|YP_697239.1|
Sequence length 476
Comment FAD-dependent oxidoreductase [Clostridium perfringens ATCC 13124]
Sequence
MIYDVAIIGSGVIGGAIFRELTKYNLKVVELEKENDVAMGASKANSAIVHSGYDPEPGTL
MAKYNVEGNKMFDKLCKDLSVPFKRNGSLIIGFDEDDQKELEVLYNRGIQNGVEGVKLLS
AEEILEMEPNLNKDVKGALFCPTGGIVGAYEFTIALSENAIDNGGELRLNSKVVGIEKDE
NFKIKLENGDVVEARFVVNAAGIYADKIHNMVCEEDFKITPRKGEYYVLDKSQGRLFEKT
IFQCPTKLGKGVLVTPTVHGNLLVGPDAIDTCDKDSVSTEYDGLAKVREVSLKTTNKVNF
RENIRNFAGLRAIADKPDFIIGEAKDVKGFFDVAGIKSPGLSSAPAIAVDVVKMLGESGL
ALEKKDNFNEKREQVHFIELSPEEKANLIKKDSRYGRIICRCENITEGEIVDSINRTLGA
RTIDGVKRRCRPGCGRCQGGFCGPRVQEIISRETGMNIEEVLLDKNGSYIISGKTK
Download sequence
Identical sequences A0A0H2YRH0
195103.CPF_2875 gi|110799968|ref|YP_697239.1| WP_011591163.1.50147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]