SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800070|ref|YP_696336.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800070|ref|YP_696336.1|
Domain Number 1 Region: 5-165
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 3.05e-48
Family gamma-carbonic anhydrase-like 0.0000629
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110800070|ref|YP_696336.1|
Sequence length 167
Comment hexapeptide repeat-containing transferase [Clostridium perfringens ATCC 13124]
Sequence
MLIEIRGKKPEIGEKTFIAHSSDIIGDVTIGRDCGIWFGSVIRGDDNLIKIGNETNVQDN
AVLHVDKEHTIEIGSGVTIGHGAIIHGCKIEDECLIGMGAIILNGAKIGKNTMIAAGTLV
SQNKEIPEGVLVMGVPGKVVRKLTEDEIESIKNSRREYVKMKNLYIK
Download sequence
Identical sequences A0A0H2YSL5 A0A133MVA7 B1BG82 B1BVW3 B1RAL1 B1V4Y6 Q8XJV2
195102.CPE1651 195103.CPF_1903 gi|18310633|ref|NP_562567.1| gi|110800070|ref|YP_696336.1| WP_003449781.1.100517 WP_003449781.1.10161 WP_003449781.1.2058 WP_003449781.1.20964 WP_003449781.1.22226 WP_003449781.1.23119 WP_003449781.1.24595 WP_003449781.1.27257 WP_003449781.1.27537 WP_003449781.1.30163 WP_003449781.1.31832 WP_003449781.1.32463 WP_003449781.1.35472 WP_003449781.1.39851 WP_003449781.1.4402 WP_003449781.1.50147 WP_003449781.1.50713 WP_003449781.1.52260 WP_003449781.1.5234 WP_003449781.1.52659 WP_003449781.1.68380 WP_003449781.1.81392 WP_003449781.1.90682 WP_003449781.1.98368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]