SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800110|ref|YP_694868.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800110|ref|YP_694868.1|
Domain Number 1 Region: 3-221,312-368
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.91e-47
Family FAD-linked reductases, N-terminal domain 0.0085
Further Details:      
 
Domain Number 2 Region: 220-311
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000576
Family D-aminoacid oxidase-like 0.016
Further Details:      
 
Weak hits

Sequence:  gi|110800110|ref|YP_694868.1|
Domain Number - Region: 383-404
Classification Level Classification E-value
Superfamily Ferredoxin thioredoxin reductase (FTR), catalytic beta chain 0.0955
Family Ferredoxin thioredoxin reductase (FTR), catalytic beta chain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110800110|ref|YP_694868.1|
Sequence length 473
Comment oxidoreductase, FAD-binding [Clostridium perfringens ATCC 13124]
Sequence
MRDIIVIGAGVVGCSIARELSKYNLDVLVVEKNSDVSEGISKGNSGIVHAGYNEKIGTLK
AKLNIEGNKIFDDLSRDLQFPFKRNGAFILAFSDEEMKTLESLKENGEKLGVEGLEILTR
EEALNIEPNLNKKIVGVLNVKTSGIVSPYEMTIALAENAAENGVEFKLNSKVTSIEKISE
GYKVTLNNKEVVNGKLIINASGLEGAFLNNLVSMTKREINPVKGEYCLFDKVAGAMINKT
LFQVPNKLSKGVLVTPTAEGNLLVGPNAVEGKTLETSREGIDEILDKSKKSLEELPVARI
LNTFSGIRPKTKGGDFIIEEVEDAKNFINVIGIDSPGLTAAPAIGVYVVNMIKERLDLVE
KKNFKKTREKIVRFAELSLKEKNKLIKEKPAYGHMVCKCEFVTEGEIVEAIHRPIKALTV
DAIKRRTRASMGGCQGIGCTLPISKILSRELGIDISDINKNSEGSPVIGFKED
Download sequence
Identical sequences A0A0H2YTA4
gi|110800110|ref|YP_694868.1| 195103.CPF_0411 WP_011590181.1.50147 WP_011590181.1.51349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]