SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800191|ref|YP_695561.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800191|ref|YP_695561.1|
Domain Number 1 Region: 13-285
Classification Level Classification E-value
Superfamily MetI-like 1.03e-65
Family MetI-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110800191|ref|YP_695561.1|
Sequence length 285
Comment sugar ABC transporter permease [Clostridium perfringens ATCC 13124]
Sequence
MMNKVKSSGIKKKDKKLWGLELAMILLAAIWFIPIYYLIVTTFKSPQEATASPLGIPKTW
IFENYSNAWKQMSFPRAFGNTVFITATAVILIVVFGSMAGYALARTKTKLGNRMFLLFLA
GLIVPFQMNIVSLYKIVKSLHLMNSAFAVILVNVAINTPQAIFLFKEFIEATIPMELEEA
ADIDGCGVLKKFFRVILPLLKPVISTVVIIVTLNVWNEFLTPLLFLQSRENGVILQEVSR
NIGQFSTDWTALFPMLMLGVAPLMVFYIFMQKYIIGGVTTGAVKG
Download sequence
Identical sequences A0A0H2YTH1 A0A133ND48 B1BJF3 B1BTJ7 B1R5A7 B1V278
WP_003451790.1.100517 WP_003451790.1.10161 WP_003451790.1.2058 WP_003451790.1.20964 WP_003451790.1.22226 WP_003451790.1.23119 WP_003451790.1.24595 WP_003451790.1.27537 WP_003451790.1.30163 WP_003451790.1.35472 WP_003451790.1.39851 WP_003451790.1.43003 WP_003451790.1.50147 WP_003451790.1.50713 WP_003451790.1.51349 WP_003451790.1.52260 WP_003451790.1.5234 WP_003451790.1.52659 WP_003451790.1.5667 WP_003451790.1.68380 WP_003451790.1.81392 WP_003451790.1.90682 WP_003451790.1.98368 gi|110800191|ref|YP_695561.1| 195103.CPF_1115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]