SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800299|ref|YP_694992.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800299|ref|YP_694992.1|
Domain Number 1 Region: 247-514
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.62e-72
Family Phosphate binding protein-like 0.00000346
Further Details:      
 
Domain Number 2 Region: 14-199
Classification Level Classification E-value
Superfamily MetI-like 1.7e-38
Family MetI-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110800299|ref|YP_694992.1|
Sequence length 517
Comment glycine betaine/L-proline ABC transporter permease/glycine betaine/L-proline-binding protein [Clostridium perfringens ATCC 13124]
Sequence
MNSLLQYVISQKTQILDLLVQHIYLTITAIGIAILIGVPLGILVSRVKFLRKPIIGFVNL
VQAVPSMALLGLLIPILGIGSTPAIFMVVVYSLLPIVKNTYTGISGIDPVVLESAKGIGL
TKNQSLFKIQLPLALPIIMSGIRISAVTAVGLMTLAAFIGAGGLGYLVFSGVQTVNNNMI
LAGAIPACILALIVDFIFGKIEVAVTPKGLSNDNKKKNTFVLKIISVIMIIAILFMGISS
FISSKKDKVVIGSKNFTEQLILGNMYADLVQDKTDLQVEKKLNLGGTSVAFGALEKGDVD
MYVDYTGTLLVNVMKENNIDNSVDYYNSIKENMNKEHGLTVMEPLGFNNTYNIAISKELA
DKYKINTISDLSKYSNDFVLSPTIEFQNRQDGLVGLKNYYGMDFKNVKSLDGSLRYSALS
NGESQAIDAFSTDGLLKKFDLKTLEDDKKFFVNYSAVPIVNNKTLEKYPQLKDVLNSLSG
KINEEKMIDLNYEVDVLGKSPEEVAKAFLIREGLIEQ
Download sequence
Identical sequences A0A0H2YTQ8
gi|110800299|ref|YP_694992.1| WP_011590244.1.43003 WP_011590244.1.50147 195103.CPF_0538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]