SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800372|ref|YP_696560.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800372|ref|YP_696560.1|
Domain Number 1 Region: 37-335
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.16e-61
Family FMN-linked oxidoreductases 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110800372|ref|YP_696560.1|
Sequence length 340
Comment FMN-dependent dehydrogenase [Clostridium perfringens ATCC 13124]
Sequence
MNKDMRDKARELYNGSCRVCKVCNGVACAGEVPGMGGKGTGDSFIRNVAALEEIKLNMRT
IHDAKNPTTNIEIFGKNMELPLFAAPITGTMLNMGGKVSEREYIEGVVKGCLDSGIYPMV
GDTAVDLCLATNLEVIEEYNGQGIIFIKPWKNEVVIEKIKMAEKAGAFAVGVDIDAAGLI
TLAMNGKPVEPKNLEEIKELVNSTKLPFILKGIMTPDEAELAVEAGVDAIVVSNHGGRVL
DQTPASCEVLPEIAARVKGKVKILVDGGVRTGVDILKMIALGADCVLIGRPFITATFAHG
AKGVEEYVNSLKGELKSAMVLTGCNSIENIDNRVIYKGEN
Download sequence
Identical sequences A0A0H2YSL1 B1RB51
gi|110800372|ref|YP_696560.1| 195103.CPF_2132 WP_003460161.1.20964 WP_003460161.1.27537 WP_003460161.1.30163 WP_003460161.1.50147 WP_003460161.1.52260 WP_003460161.1.5234 WP_003460161.1.52659 WP_003460161.1.68380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]