SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800409|ref|YP_695029.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800409|ref|YP_695029.1|
Domain Number 1 Region: 29-298
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.08e-81
Family Alanine racemase-like, N-terminal domain 0.00000254
Further Details:      
 
Domain Number 2 Region: 272-430
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.07e-49
Family Eukaryotic ODC-like 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110800409|ref|YP_695029.1|
Sequence length 431
Comment diaminopimelate decarboxylase [Clostridium perfringens ATCC 13124]
Sequence
MKLFGSMKVEENELYVGGVKASALSKEYGTPLYVIDEELVRSNCRRYYNAMKCEERGNRV
TYAGKAFINMSMCNLVNEENLYLDVVSGGELYTAYKAGFPLERIYFHGNNKSDYEIDLGV
RLGIGRFIVDNIHELEVLNSIAQEYGRVQKVYLRITPGVEAHTHEYIKTGQLDSKFGFPV
IGDTVYDAIKRAMELEYIELNGLHCHIGSQIFDLEPFEDTTEIMLNLINDIKETLGYEIK
ELDLGGGFGIYYTEGDKPKEIEEYCSVIINKADEICRKLNMNVPILSIEPGRSIVGNAGL
TLYTVGAIKEIPNIRKYVSVDGGMSDNIRPALYSANYESLIANRVFDNSKEIVTVAGKCC
ESGDVLLNSIEMPRMETGDILAIMSTGAYGHSMANNYNRIPKAAVVSVSNGISKVMCKRE
TYEDLLRNECF
Download sequence
Identical sequences A0A0H2YSM9 A0A1U9V5E7 B1BUS5 B1RB75
gi|110800409|ref|YP_695029.1| WP_003460208.1.100517 WP_003460208.1.10161 WP_003460208.1.2058 WP_003460208.1.20964 WP_003460208.1.27537 WP_003460208.1.30163 WP_003460208.1.43003 WP_003460208.1.50147 WP_003460208.1.52260 WP_003460208.1.5234 WP_003460208.1.52659 WP_003460208.1.5667 WP_003460208.1.68380 WP_003460208.1.90682 WP_003460208.1.98368 195103.CPF_0576 NYSGRC-FDAO-ABG84043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]