SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800441|ref|YP_696427.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800441|ref|YP_696427.1|
Domain Number 1 Region: 141-439
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 6.56e-69
Family NOL1/NOP2/sun 0.0000568
Further Details:      
 
Domain Number 2 Region: 2-127
Classification Level Classification E-value
Superfamily NusB-like 9.94e-33
Family RmsB N-terminal domain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110800441|ref|YP_696427.1|
Sequence length 442
Comment ribosomal RNA small subunit methyltransferase B [Clostridium perfringens ATCC 13124]
Sequence
MNARKIIVEILDNVLLNGAYSNIEINKQFASNDIDPKDKGLITEVVYGTIKYKKMIDIIL
SSFVADIGKIDESVVNILRSAIYQMKFLDRVPPYAIVNEAVNLTKETEPNLAKFVNGVLR
NYLRNENKNFKVGLRNNEALCYDFSFDRWMIEMFIKQYGKEDALRILRGLNTVPYVTVRV
NTCKADYDEVYERLEEEGYDIEEGAFSPEAIIIKKGSAIEKNKLYQEGLITVQDESAMLV
APLFDLRGDEQVMDLCSAPGTKATHIGELMMNKGKVVAFDIHDHKLALIKENIDRLGLTN
VEVELGDATKINSKYINWADRVLLDVPCSGLGIIRKKPEIKWNKKNNDLTEVVKVQKEIL
KNAWNYLREGGELVYSTCTLNKKENEEVIDWFVERNSDCEVEKVFLGKADNVVYNDNGSV
TILPNKYMDGFFIAKLKKKESK
Download sequence
Identical sequences A0A0H2YSV4 A0A1U9VB68
195103.CPF_1994 gi|110800441|ref|YP_696427.1| WP_011590944.1.10161 WP_011590944.1.2058 WP_011590944.1.23119 WP_011590944.1.50147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]