SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800466|ref|YP_697261.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800466|ref|YP_697261.1|
Domain Number 1 Region: 128-399
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.72e-107
Family BC ATP-binding domain-like 0.000000196
Further Details:      
 
Domain Number 2 Region: 669-930
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.65e-93
Family BC ATP-binding domain-like 0.00000282
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily PreATP-grasp domain 9.06e-51
Family BC N-terminal domain-like 0.00000741
Further Details:      
 
Domain Number 4 Region: 553-671
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.3e-46
Family BC N-terminal domain-like 0.00000914
Further Details:      
 
Domain Number 5 Region: 395-549
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 7.85e-46
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00012
Further Details:      
 
Domain Number 6 Region: 940-1059
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 3.66e-32
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110800466|ref|YP_697261.1|
Sequence length 1067
Comment carbamoyl phosphate synthase large subunit [Clostridium perfringens ATCC 13124]
Sequence
MPLNKDIKKVLVIGSGPIIIGQAAEFDYSGTQACQALKEEGIEVVLVNSNPATIMTDKEI
ADKVYLEPLTVEFVEKVIEKERPDSLLAGMGGQTGLNLAVELYEKGILDKYNVKVIGTSI
ESIKEGEDRELFRDMMNRINQPVIQSEIITDLDAGIAFARKIGYPVIVRPAYTLGGTGGG
IANNEEELIETLTSGLQLSTIGQVLLEKSVKGWKEIEYEVMRDSFGNCITVCNMENIDPV
GIHTGDSIVVAPSQTLSDKEYQMLRSASIDIINAVGIEGGCNVQFALNPHSFEYAVIEIN
PRVSRSSALASKATGYPIAKVAAKIALGYGLDEIKNAVTGMTYACFEPSLDYVVVKIPKW
PFDKFQGADRALGTKMMATGEIMAIGSNFEAAFLKGIRSLEIGKYSLEHKKFKDLSMYEL
RERVVSPDDERIFALAEMLRRGYRIDMVSKITGIDIFFLEKFRWLVEEEQKLKQSTIDDL
NREWLLKLKRRGFSDKAIADMLKVSPDEIYRLRDIWHIKPAYKMVDTCGGEFEALSPYYY
STYEQYDEVVVSDNKKVVVIGSGPIRIGQGIEFDYASVHCVMALRKQEIETIVINNNPET
VSTDFSISDKLYFEPLTEEDVLNIIDKEKPDGVILQFGGQTAIKLAKFLKEKNIPTLGTT
SDQIDLAEDREQFDDLLERLNIARPKGKGVWSLEEGLEEARRLGFPILVRPSFVLGGQGM
EITHDEEELTYYLTNAFEKDSKNPILIDKYLMGREIEVDAISDGEDVLVPGIMEHLERAG
VHSGDSITMYPAQNISDKIKEDVLDYTKKLALSIGIKGMINIQFIEFEGKLYVIEVNPRA
SRTVPYISKVSGVPIVDIATRIMLGERLKDLGYGTGVYKEPDLVSVKVPVFSTQKLPNVE
VSLGPEMRSTGEVLGVGRNVFEALYKGFVGASMYTGDKGKTILATIKKHDKKEFMELAKD
LDKLGYNFIATTGTAKELREAGIDAKEVRRIGEESPNIMDLIKNKEIDLVVNTPTKANDS
KRDGFHIRRAAIERNIGVMTSLDTLKALVELQKEGAHNRELEVFNLI
Download sequence
Identical sequences B1R683 Q0TM79
WP_003456883.1.27537 WP_003456883.1.31832 WP_003456883.1.4402 WP_003456883.1.50147 gi|110800466|ref|YP_697261.1| 195103.CPF_2897 NYSGRC-FDAO-ABG84100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]