SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800475|ref|YP_696572.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800475|ref|YP_696572.1|
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Ribosomal protein L20 5.36e-47
Family Ribosomal protein L20 0.0000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110800475|ref|YP_696572.1|
Sequence length 119
Comment 50S ribosomal protein L20 [Clostridium perfringens ATCC 13124]
Sequence
MARVKRAVNARKNHKKVLKLAKGYYGGKSKLFKTANESVIRALRNAYVGRRLKKRDYRRL
WIARINAATRMNGLSYSRFMNGMKLAGVDINRKMLSEIAINDPKAFADLVELAKKHLNA
Download sequence
Identical sequences A0A133N939 B1BIX1 B1BT19 B1RB39 B1V526 Q0SRT7 Q0TP68 Q8XJ69
195102.CPE1892 195103.CPF_2144 289380.CPR_1856 gi|110803986|ref|YP_699170.1| gi|110800475|ref|YP_696572.1| gi|18310874|ref|NP_562808.1| WP_003451332.1.100517 WP_003451332.1.10161 WP_003451332.1.1075 WP_003451332.1.13323 WP_003451332.1.1394 WP_003451332.1.14338 WP_003451332.1.17789 WP_003451332.1.2058 WP_003451332.1.20964 WP_003451332.1.22226 WP_003451332.1.23119 WP_003451332.1.24595 WP_003451332.1.27257 WP_003451332.1.27360 WP_003451332.1.27537 WP_003451332.1.28470 WP_003451332.1.28529 WP_003451332.1.29129 WP_003451332.1.29428 WP_003451332.1.30163 WP_003451332.1.31832 WP_003451332.1.3228 WP_003451332.1.32463 WP_003451332.1.35472 WP_003451332.1.43003 WP_003451332.1.4345 WP_003451332.1.4402 WP_003451332.1.44743 WP_003451332.1.48074 WP_003451332.1.4818 WP_003451332.1.50147 WP_003451332.1.50713 WP_003451332.1.51349 WP_003451332.1.52260 WP_003451332.1.5234 WP_003451332.1.52659 WP_003451332.1.5667 WP_003451332.1.64066 WP_003451332.1.66593 WP_003451332.1.67534 WP_003451332.1.68380 WP_003451332.1.76352 WP_003451332.1.78174 WP_003451332.1.81392 WP_003451332.1.83225 WP_003451332.1.85755 WP_003451332.1.87374 WP_003451332.1.90682 WP_003451332.1.93653 WP_003451332.1.96543 WP_003451332.1.98368 WP_003451332.1.99566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]