SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800506|ref|YP_696778.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800506|ref|YP_696778.1|
Domain Number 1 Region: 335-474
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.67e-28
Family Histidine kinase 0.0034
Further Details:      
 
Domain Number 2 Region: 249-328
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000116
Family Homodimeric domain of signal transducing histidine kinase 0.0015
Further Details:      
 
Domain Number 3 Region: 197-247
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000000641
Family HAMP domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110800506|ref|YP_696778.1|
Sequence length 482
Comment sensor histidine kinase [Clostridium perfringens ATCC 13124]
Sequence
MKVKHKFSGGFLIIFLIAFIILNCFLGKAFINYHENKIKNEMDSLYKSSYSILRLYFQVN
NLEGNKGNFNRYIPKISNDISEQGKCQIDVFNEDLEKEYSYYLDDFSFDYEKDGGYDVLK
EANKNKAALNIYRDENAVKAYLAFPVYVDESFLGNILLSKDYSKEYLELRDLMSNIKFIV
SITFLLILIFTYFLFERIINPLNYIKNSFKRIGDGDFKINLKVNSKDEIGDLACGVNKMA
NKIEEQIEKINEEKEKVLTLEKTRTEFFNNITHELKTPLTNISGYAQIMSEEDFHDNDFR
KFALERINKESKRMHELIVSLIEISKNKSDIEGGEIENVNLKTLIEDLCEDFKVKGDKQG
ICISNNLEDIEFMCREDEIRRIIINLLDNAIKYSIKGSEIEISLFKDKEEKHIEIENLSD
EISSEGVEKIFEPFYRENTKKSRELGGNGLGLYICSELVKKYGGDISFNYSNGKVKVSII
FK
Download sequence
Identical sequences A0A0H2YSY2
gi|110800506|ref|YP_696778.1| IDP04012 195103.CPF_2355 WP_011591049.1.50147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]