SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800557|ref|YP_694485.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800557|ref|YP_694485.1|
Domain Number 1 Region: 2-217,299-356
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.03e-32
Family FAD-linked reductases, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110800557|ref|YP_694485.1|
Sequence length 464
Comment FAD-dependent oxidoreductase [Clostridium perfringens ATCC 13124]
Sequence
MDYDVLILGGGIIGCSVAYELSKYNLNIALIEKDFDIADDVSFVNTAIVYDGSECKDNLM
SYLENMGNMMLPEITKKLNVPFKRVGHLTIADNDETVRIIEENYKRAKSRGINNIYLIDE
KRAREIEPNYKGEIKKAMYSENIAVTSPYDLAIGFAEIAYDNGVSFRLEEVVLDIQSIAK
GFKVTTNKNKFTCRFVINTTPSEHYTIDQDKDYEQKNALKTYYLLLNDEIKEKTSNIVVK
LKNEEEFIIQKNTVNGDTLIGINSNNSLGFMKSLKIAKEMINSISRKHVKDIFYDNHNQD
RLIIDDSRKNKGYIKVMGNHYGEVTIAPAVSKIICDEIIDKLNCSLNKNFVDKRREFYRF
RELSNEERNELISLDKRYGKIVCLCNGISEGEIVDCIRRPLGARTVEGVKRRTGATFGTC
HGAYCISKIINILARELEKKPTEIVEDSKNSKVLASRIKEFDRV
Download sequence
Identical sequences A0A0H2YT18 A0A1U9V5E8 B1R807
gi|110800557|ref|YP_694485.1| WP_003458179.1.100517 WP_003458179.1.10161 WP_003458179.1.2058 WP_003458179.1.20964 WP_003458179.1.27537 WP_003458179.1.30163 WP_003458179.1.50147 WP_003458179.1.52260 WP_003458179.1.5234 WP_003458179.1.52659 WP_003458179.1.68380 195103.CPF_0012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]