SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800614|ref|YP_694650.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|110800614|ref|YP_694650.1|
Domain Number - Region: 4-90
Classification Level Classification E-value
Superfamily MetI-like 0.00327
Family MetI-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110800614|ref|YP_694650.1|
Sequence length 103
Comment cobalt transport protein CbiN [Clostridium perfringens ATCC 13124]
Sequence
MKNKRVLTNVILLLLVVFITIIPFFVAKNGEFGGSDDQAEEAITQIDENYEPWFSPLFEP
ASGEIESLLFALQAAIGAGVIGFGLGYLKGKKKVNDEVNDKHR
Download sequence
Identical sequences A0A0H2YUH9 A0A133N9N2 B1BKM9 B1BS04 B1R7C8 B1V168 Q8XNY9
gi|110800614|ref|YP_694650.1| gi|18309175|ref|NP_561109.1| WP_003452599.1.100517 WP_003452599.1.10161 WP_003452599.1.1075 WP_003452599.1.13323 WP_003452599.1.1394 WP_003452599.1.14338 WP_003452599.1.17789 WP_003452599.1.2058 WP_003452599.1.20964 WP_003452599.1.22226 WP_003452599.1.23119 WP_003452599.1.24595 WP_003452599.1.27257 WP_003452599.1.27360 WP_003452599.1.27537 WP_003452599.1.28470 WP_003452599.1.28529 WP_003452599.1.29129 WP_003452599.1.29428 WP_003452599.1.30163 WP_003452599.1.31832 WP_003452599.1.3228 WP_003452599.1.32463 WP_003452599.1.35472 WP_003452599.1.39851 WP_003452599.1.43003 WP_003452599.1.4345 WP_003452599.1.4402 WP_003452599.1.44743 WP_003452599.1.48074 WP_003452599.1.4818 WP_003452599.1.50147 WP_003452599.1.50713 WP_003452599.1.51349 WP_003452599.1.52260 WP_003452599.1.5234 WP_003452599.1.52659 WP_003452599.1.5667 WP_003452599.1.64066 WP_003452599.1.66593 WP_003452599.1.67534 WP_003452599.1.68380 WP_003452599.1.76352 WP_003452599.1.78174 WP_003452599.1.83225 WP_003452599.1.85755 WP_003452599.1.87374 WP_003452599.1.90682 WP_003452599.1.93653 WP_003452599.1.96543 WP_003452599.1.98368 WP_003452599.1.99566 195102.CPE0193 195103.CPF_0186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]