SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800713|ref|YP_696764.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800713|ref|YP_696764.1|
Domain Number 1 Region: 2-213
Classification Level Classification E-value
Superfamily MetI-like 2.09e-44
Family MetI-like 0.0000869
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110800713|ref|YP_696764.1|
Sequence length 218
Comment molybdate ABC transporter permease [Clostridium perfringens ATCC 13124]
Sequence
MIWEALLISLKVVLVSVFLSCVLGILLGYFMVEKNFKFKYIIETIIIFPMFLPPSAVGYL
ILLILGKKGVIGEFLYNNFDMSIIFTWIGAVIVGIVVSIPIMYQSLKTSLLSVNEDVKNA
AREMGAINFKLYRLISLPLSKKGLYTGIVLSIARVFGEFGATILVAGNIQGKTQTIPMAM
YYAIENGDSGLANKILILIVLISVILTFSYNKIIKRIK
Download sequence
Identical sequences A0A0H2YTF7 A0A1U9VBI1 B1R3G7
WP_003455194.1.100517 WP_003455194.1.10161 WP_003455194.1.2058 WP_003455194.1.20964 WP_003455194.1.22226 WP_003455194.1.27257 WP_003455194.1.27537 WP_003455194.1.30163 WP_003455194.1.50147 WP_003455194.1.5234 WP_003455194.1.52659 WP_003455194.1.5667 195103.CPF_2341 gi|110800713|ref|YP_696764.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]