SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800757|ref|YP_696568.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800757|ref|YP_696568.1|
Domain Number 1 Region: 93-339
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.14e-82
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000126
Further Details:      
 
Domain Number 2 Region: 13-99
Classification Level Classification E-value
Superfamily tRNA-binding arm 1.26e-19
Family Phenylalanyl-tRNA synthetase (PheRS) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110800757|ref|YP_696568.1|
Sequence length 339
Comment phenylalanyl-tRNA synthetase subunit alpha [Clostridium perfringens ATCC 13124]
Sequence
MQDKLNQIKELALVEIKEAKDSTTIDTIRVKYLGKKGELTTILRGMGSLSKEERPIVGKL
ANEVREVLEAELEAVTKAVKEAEKQEKLKNEVIDISMPGKKQTIGKKHPLEQTLDEMKKI
FVSMGFAIEDGPEVEKDYYNFEALNIPKNHPARSEQDTFYINDNVVLRTQTSPVQARVME
KQQPPIKMISPGKVFRSDAVDATHSPIFYQMEGLVIDKDITFADLKGTLELFAKKMFGDK
VKTKFRPHHFPFTEPSAEMDATCFVCNGKGCKVCKGEGWIEILGCGMVHPQVLRNCGIDP
EVYSGFAFGFGVDRMVMLKYGIDDIRLLYESDMRFLNQF
Download sequence
Identical sequences B1BIX5 B1BT23 B1V523 Q0TP72
WP_003451091.1.22226 WP_003451091.1.23119 WP_003451091.1.24595 WP_003451091.1.31832 WP_003451091.1.43003 WP_003451091.1.4402 WP_003451091.1.50147 WP_003451091.1.50713 WP_003451091.1.51349 WP_003451091.1.90682 WP_003451091.1.98368 195103.CPF_2140 gi|110800757|ref|YP_696568.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]