SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800890|ref|YP_697237.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800890|ref|YP_697237.1|
Domain Number 1 Region: 43-114
Classification Level Classification E-value
Superfamily CPE0013-like 1.31e-24
Family CPE0013-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110800890|ref|YP_697237.1|
Sequence length 115
Comment hypothetical protein CPF_2873 [Clostridium perfringens ATCC 13124]
Sequence
MVKELICIVCPRGCHLTVDTELEKVTGNTCKRGEIYGLNEVKNPTRIVTSTVKIDGCDNI
VVPVKTEEPIPKGMIFDVMKEINKASVKLPIKVGDVIIEDVLGTGVSIVSAKTVS
Download sequence
Identical sequences A0A0H2YUK8 A0A140GTW2 B1BHP2 B1R660 B1UZU3 Q0SQ04 Q8XHD6
gi|110800890|ref|YP_697237.1| gi|18311531|ref|NP_563465.1| CpR39 195102.CPE2549 195103.CPF_2873 289380.CPR_2556 gi|110802590|ref|YP_699803.1| WP_003450634.1.100517 WP_003450634.1.10161 WP_003450634.1.1075 WP_003450634.1.13323 WP_003450634.1.1394 WP_003450634.1.14338 WP_003450634.1.17789 WP_003450634.1.2058 WP_003450634.1.20964 WP_003450634.1.22226 WP_003450634.1.23119 WP_003450634.1.24595 WP_003450634.1.27257 WP_003450634.1.27360 WP_003450634.1.27537 WP_003450634.1.28470 WP_003450634.1.28529 WP_003450634.1.29129 WP_003450634.1.29428 WP_003450634.1.30163 WP_003450634.1.31832 WP_003450634.1.3228 WP_003450634.1.32463 WP_003450634.1.39851 WP_003450634.1.43003 WP_003450634.1.4345 WP_003450634.1.4402 WP_003450634.1.44743 WP_003450634.1.48074 WP_003450634.1.4818 WP_003450634.1.50147 WP_003450634.1.50713 WP_003450634.1.51349 WP_003450634.1.52260 WP_003450634.1.5234 WP_003450634.1.52659 WP_003450634.1.5667 WP_003450634.1.64066 WP_003450634.1.66593 WP_003450634.1.67534 WP_003450634.1.68380 WP_003450634.1.76352 WP_003450634.1.78174 WP_003450634.1.81392 WP_003450634.1.83225 WP_003450634.1.85755 WP_003450634.1.87374 WP_003450634.1.93653 WP_003450634.1.96543 WP_003450634.1.99566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]