SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800907|ref|YP_694898.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800907|ref|YP_694898.1|
Domain Number 1 Region: 5-256
Classification Level Classification E-value
Superfamily MetI-like 1.96e-39
Family MetI-like 0.0006
Further Details:      
 
Domain Number 2 Region: 287-527
Classification Level Classification E-value
Superfamily MetI-like 7.41e-35
Family MetI-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110800907|ref|YP_694898.1|
Sequence length 533
Comment iron ABC transporter permease [Clostridium perfringens ATCC 13124]
Sequence
MEIMKKIKFNGWALLSTIISLMIVLPNIDIIIHLFQKPNKTWYHIKEYLLKDYIVTSIIV
VFFTVLLSIIIGVTLAWLISAYDFPFRKFFRWALILPLAIPPYIGAYTYSGMVSYTGVIQ
RFFRNILGVELNQKYFDIMSIEGAIFIFTLFLFPYVYMVTMTFLEKQSAGLIESARLLGS
SAIGIFFRVIIPVSRGAIVAGSTLIALEVLSDYGVVSYLGVQTFSTAIFKSWISLGDVDS
AIRLAGILMVVVFIIISSEKALRGRKKYSFTNTKVRPIKRKNLKGFNKFIVTLYVLIIFS
LGFLIPVLQMIAWAIASYKNIYYSQFLSMIFNSVILASGCSLLIVIMALIVANYVRTRSG
LLSKIYAKVTLIGYSIPGAVVAITMILFFVDIDNKIKGLALSTSIIMLVFAYVIRFLAIG
YQNIEGGFEKIGNKFTEASRTLGYGVTKTFFKVDIHMLKPAILGAFALTFVDIIKELPLV
LTLRPFNFYTLSTKVFEYANDEMIPESAIPSLIIVFVSFVAIYFLYKVADKED
Download sequence
Identical sequences A0A0H2YUM4
195103.CPF_0441 gi|110800907|ref|YP_694898.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]