SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800913|ref|YP_696589.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800913|ref|YP_696589.1|
Domain Number 1 Region: 89-227
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 1.05e-50
Family Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110800913|ref|YP_696589.1|
Sequence length 236
Comment 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [Clostridium perfringens ATCC 13124]
Sequence
MSYNFTDPYEIARFIKEVKKSTPVKVYLKGNLEGVELGSIECYGNNDFYVLFGESDEVAT
FLTENKDKIVSFRLENDRRNSAIPMLDLLNINARIEPGAIIRDRVSIGDNAVIMMGAVIN
IGAEIGESTMVDMNAVIGARGKLGKRVHLGAGAVVAGVLEPPSKTPCIIEDDVLIGANAV
ILEGVKIGKGSVVAAGSVVVEDVPAGVVVAGTPAKIIKSVDEKTKDKTEILDDLRK
Download sequence
Identical sequences A0A140GSA0 B1BYB6 B1R2Y0 B1V7F4 Q0TP51 Q8XJ52
gi|18310891|ref|NP_562825.1| 195102.CPE1909 195103.CPF_2165 WP_003454957.1.100517 WP_003454957.1.10161 WP_003454957.1.1075 WP_003454957.1.1394 WP_003454957.1.14338 WP_003454957.1.17789 WP_003454957.1.2058 WP_003454957.1.20964 WP_003454957.1.22226 WP_003454957.1.23119 WP_003454957.1.27257 WP_003454957.1.27360 WP_003454957.1.27537 WP_003454957.1.28470 WP_003454957.1.28529 WP_003454957.1.29129 WP_003454957.1.29428 WP_003454957.1.30163 WP_003454957.1.31832 WP_003454957.1.3228 WP_003454957.1.32463 WP_003454957.1.39851 WP_003454957.1.43003 WP_003454957.1.4345 WP_003454957.1.4402 WP_003454957.1.44743 WP_003454957.1.48074 WP_003454957.1.4818 WP_003454957.1.50147 WP_003454957.1.50713 WP_003454957.1.52260 WP_003454957.1.5234 WP_003454957.1.52659 WP_003454957.1.64066 WP_003454957.1.66593 WP_003454957.1.67534 WP_003454957.1.68380 WP_003454957.1.76352 WP_003454957.1.78174 WP_003454957.1.81392 WP_003454957.1.83225 WP_003454957.1.85755 WP_003454957.1.87374 WP_003454957.1.90682 WP_003454957.1.93653 WP_003454957.1.96543 WP_003454957.1.98368 WP_003454957.1.99566 gi|110800913|ref|YP_696589.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]